Detailed information of effector


Summary

Effector ID EFF01037 experimental
Effector type Tse
Cognate immunity protein IMU00274 experimental
Related T6SS (Type) T6SS00003 experimental (Type i3)
Strain Pseudomonas aeruginosa PAO1
Replicon chromosome
Sequence Protein sequence (196 a.a.); Nucleotide sequence (588 bp)
Description Tse4
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PA2774 (Tse4)
Coordinates (Strand) 3132229..3132816 (-)
NCBI ID 15597970
RefSeq NC_002516
Uniprot ID TSE4_PSEAE
KEGG ID pae:PA2774
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-14 MSQLPIPLPLNESR
Transmembrane helix 15-37 WRYVTASGGGMTVAFLAGSGGSI
Inside 38-113 TLLSPEGENVSFRYGGVGGGIGLGMRLPRFGKVNLNVKGKSVGGAGALEALPSTGTVLVADGLVGRDLSRGDFTGP
Transmembrane helix 114-136 CMYVELGAGVIAGGSGTAILFGL
Outside 137-139 DPK
Transmembrane helix 140-159 LLAAVALASASPLTAALGAS
Inside 160-171 MSRQLLQSSRGA
Transmembrane helix 172-194 LLMAGVNVGAQFGGGAAAYLGAL
Outside 195-195 F



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.5930 - -



  Protein sequence: 196 a.a.    .

>EFF01037 NC_002516:c3132816-3132229 [Pseudomonas aeruginosa PAO1]
MSQLPIPLPLNESRWRYVTASGGGMTVAFLAGSGGSITLLSPEGENVSFRYGGVGGGIGLGMRLPRFGKVNLNVKGKSVG
GAGALEALPSTGTVLVADGLVGRDLSRGDFTGPCMYVELGAGVIAGGSGTAILFGLDPKLLAAVALASASPLTAALGASM
SRQLLQSSRGALLMAGVNVGAQFGGGAAAYLGALF*

  Nucleotide sequence: 588 bp    .

>EFF01037 NC_002516:c3132816-3132229 [Pseudomonas aeruginosa PAO1]
ATGTCGCAACTTCCCATTCCCTTGCCCCTCAACGAGAGTCGCTGGCGCTACGTGACGGCCAGTGGCGGAGGCATGACCGT
GGCCTTCCTGGCGGGTAGCGGCGGCTCCATCACGTTGCTCTCGCCGGAGGGTGAGAACGTGTCCTTCCGCTATGGCGGGG
TGGGCGGCGGGATCGGACTGGGCATGCGCCTGCCGCGCTTCGGCAAGGTCAACCTCAATGTCAAGGGCAAGAGCGTTGGC
GGGGCCGGTGCGCTGGAGGCGTTGCCGAGCACCGGAACCGTCTTGGTCGCGGACGGCCTGGTGGGGCGCGACCTGTCCCG
CGGCGACTTCACCGGGCCCTGCATGTACGTCGAACTCGGCGCGGGAGTCATCGCCGGCGGTTCGGGCACGGCGATCCTCT
TCGGCCTCGATCCCAAGCTGCTGGCGGCGGTGGCGCTGGCGAGCGCCTCGCCATTGACCGCCGCGCTGGGCGCCAGCATG
TCGCGGCAATTACTGCAATCGTCCCGTGGCGCCCTGTTGATGGCCGGGGTCAACGTCGGTGCACAGTTCGGCGGCGGCGC
GGCGGCTTACCTGGGGGCGTTGTTCTGA