Detailed information of effector


Summary

Effector ID EFF01035 experimental
Effector type Tse
Cognate immunity protein IMU00273 experimental
Related T6SS (Type) T6SS00003 experimental (Type i3)
Strain Pseudomonas aeruginosa PAO1
Replicon chromosome
Sequence Protein sequence (431 a.a.); Nucleotide sequence (1293 bp)
Description Tse6
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PA0093 (Tse6)
Coordinates (Strand) 113303..114595 (-)
NCBI ID 15595291
RefSeq NC_002516
Uniprot ID TSE6_PSEAE
KEGG ID pae:PA0093
PDB ID 4ZV4, 4ZV0, 6OX6

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Ntox46 PF15538.8 3.4e-97 266..422
PAAR_motif PF05488.15 4.2e-12 80..151

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-12 MDAQAAARLGDE
Transmembrane helix 13-35 IAHGFGVAAMVAGAVAGALIGAA
Outside 36-38 VVA
Transmembrane helix 39-61 ATAATGGLAAVILAGSIAAGGLS
Inside 62-188 MFQIVKGLTTIFELPEPTTGVLIRGSFNVYVNSRNAMRAGDDVSATCSGLPLNHPLWPFPVLIAEGSATVYINGKPAARLQSKMVCGAHIKTGSQNTFIGGPTERVAFVLDLEEWLHTGLEALGLAA
Transmembrane helix 189-211 LAGGLLLAAMAGVAALVGVVAIG
Outside 212-430 GLMMGGMALLGDLGDRLGPGYRDLFQGVAGMALLGFGPKLAGRRPAAVTSETAQRRAYLNNKFGRSGNLDHDINYRGNRETAAKFFKSKDIDPADAESYMNGLDFNHPVRVETLAPGKNLWQYQSPGAPQGNWYTLSPRVQPTELGINPMGTNRAANTIEPKVLNSYRTTQKVEVLRSTAAPTDDFWSVKGQSYPAKGGAQQLFSNEKGSFGLLPREGS



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.7411 - -



  Protein sequence: 431 a.a.    .

>EFF01035 NC_002516:c114595-113303 [Pseudomonas aeruginosa PAO1]
MDAQAAARLGDEIAHGFGVAAMVAGAVAGALIGAAVVAATAATGGLAAVILAGSIAAGGLSMFQIVKGLTTIFELPEPTT
GVLIRGSFNVYVNSRNAMRAGDDVSATCSGLPLNHPLWPFPVLIAEGSATVYINGKPAARLQSKMVCGAHIKTGSQNTFI
GGPTERVAFVLDLEEWLHTGLEALGLAALAGGLLLAAMAGVAALVGVVAIGGLMMGGMALLGDLGDRLGPGYRDLFQGVA
GMALLGFGPKLAGRRPAAVTSETAQRRAYLNNKFGRSGNLDHDINYRGNRETAAKFFKSKDIDPADAESYMNGLDFNHPV
RVETLAPGKNLWQYQSPGAPQGNWYTLSPRVQPTELGINPMGTNRAANTIEPKVLNSYRTTQKVEVLRSTAAPTDDFWSV
KGQSYPAKGGAQQLFSNEKGSFGLLPREGS*

  Nucleotide sequence: 1293 bp    .

>EFF01035 NC_002516:c114595-113303 [Pseudomonas aeruginosa PAO1]
ATGGATGCGCAAGCCGCCGCCCGACTGGGCGATGAGATAGCCCACGGTTTCGGTGTCGCCGCGATGGTCGCCGGAGCCGT
GGCCGGAGCCCTGATCGGCGCCGCCGTGGTCGCCGCCACCGCCGCCACCGGCGGCCTGGCCGCGGTGATCCTGGCCGGTT
CGATCGCCGCCGGCGGGCTGTCGATGTTCCAGATCGTCAAGGGCCTGACCACCATCTTCGAGCTACCCGAGCCGACCACC
GGGGTGCTCATACGCGGCAGCTTCAACGTCTACGTGAACAGTCGCAACGCGATGCGCGCCGGCGACGACGTTTCCGCCAC
CTGCAGCGGCCTGCCGCTGAACCATCCGCTGTGGCCGTTCCCGGTGCTGATCGCCGAAGGCAGCGCGACCGTGTACATCA
ACGGCAAGCCGGCGGCGCGCCTGCAGAGCAAGATGGTCTGCGGCGCGCACATCAAGACCGGCAGCCAGAACACCTTCATC
GGCGGCCCCACCGAGCGGGTGGCCTTCGTCCTCGACCTGGAGGAATGGCTGCACACCGGCCTCGAGGCGCTGGGCCTGGC
GGCCCTAGCCGGCGGCCTGCTGCTGGCGGCGATGGCCGGGGTCGCGGCGCTGGTTGGAGTGGTCGCCATCGGCGGCCTGA
TGATGGGCGGCATGGCCCTGCTCGGCGACCTCGGCGACCGCCTCGGTCCCGGCTACCGCGACCTGTTCCAGGGCGTGGCG
GGGATGGCATTGCTGGGCTTCGGGCCGAAACTCGCCGGTCGTCGTCCGGCAGCGGTGACCTCCGAAACCGCGCAACGACG
CGCCTACCTGAACAACAAGTTCGGTCGTTCCGGCAACCTCGACCACGACATCAACTACCGCGGGAATCGTGAAACCGCCG
CCAAGTTCTTCAAGTCGAAGGACATCGATCCTGCCGATGCCGAGTCGTACATGAACGGCCTGGACTTCAACCATCCGGTC
CGTGTGGAAACCCTCGCGCCCGGCAAGAACCTGTGGCAGTACCAGTCCCCCGGAGCGCCGCAGGGCAACTGGTATACACT
CAGCCCGCGCGTGCAGCCCACGGAGCTGGGAATCAACCCCATGGGCACCAACCGGGCGGCGAACACCATCGAACCCAAGG
TCCTCAACTCCTACAGGACGACCCAGAAGGTCGAGGTCCTGCGCAGCACCGCTGCGCCGACCGATGACTTCTGGTCGGTA
AAGGGACAGTCATATCCCGCCAAAGGCGGCGCGCAACAACTGTTCTCCAACGAGAAAGGCTCCTTCGGTCTGCTTCCCCG
GGAGGGATCATGA