Detailed information of effector


Summary

Effector ID EFF00544 experimental
Effector type Tse
Cognate immunity protein IMU00108 experimental
Related T6SS (Type) T6SS00443 experimental (Type i3)
Strain Methylomonas methanica MC09
Replicon chromosome
Sequence Protein sequence (160 a.a.); Nucleotide sequence (480 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) METME_RS17335
Coordinates (Strand) 3824035..3824514 (-)
NCBI ID 333985114
RefSeq NC_015572
Uniprot ID UPI00020EB7F5
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
ADPRTs_Tse2 PF18648.3 2e-62 7..153

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-159 MSYDYEKTSIDLYRAIFKGNFTTDVSCYLKPDKDLADADSIAPILHPTFSELSGEGALRRPPDIIANPDTGMYDPDTGGTSVFNRPRVLRRAEGDFFIPSGTDIPPDLKVKKDSYNERLKATHYTIMPLKPMFKESLMGQLDNFVRNAIRRQYEKARGL



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9627 - -



  Protein sequence: 160 a.a.    .

>EFF00544 NC_015572:c3824514-3824035 [Methylomonas methanica MC09]
MSYDYEKTSIDLYRAIFKGNFTTDVSCYLKPDKDLADADSIAPILHPTFSELSGEGALRRPPDIIANPDTGMYDPDTGGT
SVFNRPRVLRRAEGDFFIPSGTDIPPDLKVKKDSYNERLKATHYTIMPLKPMFKESLMGQLDNFVRNAIRRQYEKARGL*

  Nucleotide sequence: 480 bp    .

>EFF00544 NC_015572:c3824514-3824035 [Methylomonas methanica MC09]
ATGAGTTATGACTATGAAAAAACGAGTATTGACCTCTATCGCGCAATATTTAAGGGGAATTTCACAACGGATGTAAGTTG
TTATCTGAAACCGGACAAGGATTTAGCGGACGCAGACTCAATAGCACCAATTCTCCATCCAACTTTTAGCGAGCTATCAG
GAGAGGGGGCGCTAAGAAGGCCACCAGACATCATCGCTAACCCGGATACAGGAATGTATGATCCAGACACTGGAGGGACA
TCTGTGTTTAATCGACCTAGAGTATTGCGTCGTGCTGAAGGAGACTTTTTTATACCCTCAGGCACAGACATTCCACCTGA
TTTAAAAGTAAAGAAAGATAGTTACAACGAGCGCTTGAAGGCGACACACTATACAATCATGCCATTAAAACCAATGTTCA
AAGAAAGTCTCATGGGCCAGCTTGATAACTTCGTACGGAACGCTATTCGACGCCAATACGAAAAAGCTCGTGGATTGTAG