Detailed information of effector


Summary

Effector ID EFF00145 experimental
Effector type Tle
Cognate immunity protein IMU00076 experimental
Related T6SS (Type) T6SS00115 experimental (Type i4b)
Strain Burkholderia thailandensis E264
Replicon chromosome
Sequence Protein sequence (801 a.a.); Nucleotide sequence (2403 bp)
Description Tle1; Lipase
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) BTH_I2698 (Tle1)
Coordinates (Strand) 3089237..3091639 (-)
NCBI ID 83721061
RefSeq NC_007651
Uniprot ID UPI0000668539
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DUF2235 PF09994.11 4e-18 295..407
DUF2235 PF09994.11 4.7e-10 42..280

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-800 MNFRFAPAERPDIGVVTKEEKDAILRRLHDDDGMSCCKTLHIGIFFDGTRNNAERDKSGHKHSNVARLRDAFPQDRYHKSIYVAGVGTPFSSEIGDYGIGLQAVAGASAGWAGEGRINWALLQIHNAVHECAFRVGLSTALGVDDKNLVKLMSLDMNFKGIDLGGNAPQPGSTGDIKSRSSPGIGALKLIAAEQYGAELTWDKDTNWSQLKDDLDSSKWAAAVRAWDGRRRKILGDRRAQLKARVGDMLVKGKPRIQRIRLYVFGFSRGAAEARTFSNWLVDALESDFSLCGVPVSYDFLGIFDTVASVGIAQSAAATLFDGHGGWARKELMAVPHYVRRCVHMVAAHEPRGSFPLDLIDCSLEGREEIVYPGVHSDVGGGYGPAEQGRGRGDADKLSQVPLVDMYRAARIAGVPLDIQGPGITSEAADVFKISAGLKQAFTAYVKASEGYYYAKEHGTAGLMRAHYGLYLRWRRMRLKDMSLQPSFKAAQANCPQDAMDIDSANKELRAEWEDLLEIEKEGGPSVAHYAKKFGAKVARDNPKIVASVSAVLLPGVIVFSTRPEVIYGVRKAGDRVTELVRAQLQEKWEQWQQVRSDWNMGPPEAPISALYDNYMHDSRAWFKPLGDDDDVWNYKQIQELKSKQASFEREHAAWRKRAETGAPGPWQIAQAMSAGASGLGPIAMQPEPEPRSPLTAQQADLLKRYDAAMQSAKQARAAKDPNAPTDSAVLTDPKVTGGLALQTSGREFYFLWGFLRWRTVFVNGVRWDQPRVPTVQEEMEGMRMQMQRQVDMKGIGVLFQ



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9862 - -



  Protein sequence: 801 a.a.    .

>EFF00145 NC_007651:c3091639-3089237 [Burkholderia thailandensis E264]
MNFRFAPAERPDIGVVTKEEKDAILRRLHDDDGMSCCKTLHIGIFFDGTRNNAERDKSGHKHSNVARLRDAFPQDRYHKS
IYVAGVGTPFSSEIGDYGIGLQAVAGASAGWAGEGRINWALLQIHNAVHECAFRVGLSTALGVDDKNLVKLMSLDMNFKG
IDLGGNAPQPGSTGDIKSRSSPGIGALKLIAAEQYGAELTWDKDTNWSQLKDDLDSSKWAAAVRAWDGRRRKILGDRRAQ
LKARVGDMLVKGKPRIQRIRLYVFGFSRGAAEARTFSNWLVDALESDFSLCGVPVSYDFLGIFDTVASVGIAQSAAATLF
DGHGGWARKELMAVPHYVRRCVHMVAAHEPRGSFPLDLIDCSLEGREEIVYPGVHSDVGGGYGPAEQGRGRGDADKLSQV
PLVDMYRAARIAGVPLDIQGPGITSEAADVFKISAGLKQAFTAYVKASEGYYYAKEHGTAGLMRAHYGLYLRWRRMRLKD
MSLQPSFKAAQANCPQDAMDIDSANKELRAEWEDLLEIEKEGGPSVAHYAKKFGAKVARDNPKIVASVSAVLLPGVIVFS
TRPEVIYGVRKAGDRVTELVRAQLQEKWEQWQQVRSDWNMGPPEAPISALYDNYMHDSRAWFKPLGDDDDVWNYKQIQEL
KSKQASFEREHAAWRKRAETGAPGPWQIAQAMSAGASGLGPIAMQPEPEPRSPLTAQQADLLKRYDAAMQSAKQARAAKD
PNAPTDSAVLTDPKVTGGLALQTSGREFYFLWGFLRWRTVFVNGVRWDQPRVPTVQEEMEGMRMQMQRQVDMKGIGVLFQ
*

  Nucleotide sequence: 2403 bp    .

>EFF00145 NC_007651:c3091639-3089237 [Burkholderia thailandensis E264]
ATGAATTTTCGCTTTGCTCCGGCCGAACGCCCCGACATAGGCGTTGTGACGAAAGAAGAAAAGGACGCGATTCTTCGGCG
GCTTCATGACGACGATGGTATGAGTTGTTGTAAAACTCTTCACATCGGAATTTTCTTCGACGGTACGCGTAACAACGCGG
AAAGGGACAAGTCAGGGCATAAGCACAGTAACGTGGCTCGCCTTCGGGACGCGTTTCCTCAAGATCGATATCACAAGTCC
ATTTACGTCGCTGGGGTAGGGACACCTTTCTCAAGCGAAATCGGTGATTATGGTATCGGACTTCAAGCCGTGGCTGGCGC
ATCTGCCGGATGGGCTGGCGAAGGACGTATTAACTGGGCCTTATTGCAAATCCATAATGCAGTGCACGAATGTGCTTTCC
GTGTTGGTCTTAGTACCGCGCTCGGGGTGGACGACAAGAATTTGGTGAAGTTGATGAGCCTAGACATGAACTTCAAGGGC
ATCGACCTGGGTGGAAATGCTCCCCAACCTGGTAGTACAGGTGACATTAAATCGCGATCGAGCCCTGGCATCGGTGCGCT
CAAGTTGATCGCGGCCGAACAGTACGGCGCGGAGTTGACGTGGGACAAGGATACGAACTGGTCCCAGTTAAAGGATGATC
TGGATTCGTCGAAATGGGCGGCGGCTGTGCGGGCGTGGGACGGTAGACGCCGCAAGATTTTGGGCGATCGTCGTGCGCAG
TTGAAGGCGCGGGTCGGCGACATGCTTGTTAAGGGCAAGCCGAGAATCCAGCGCATTCGCCTTTATGTGTTTGGATTTTC
GCGGGGTGCAGCGGAAGCTCGCACGTTTTCGAATTGGCTTGTCGATGCACTCGAATCCGATTTCAGCCTGTGTGGTGTTC
CCGTCTCGTACGATTTCCTTGGAATTTTCGATACTGTCGCGTCAGTCGGCATTGCGCAGAGCGCCGCCGCGACACTTTTC
GATGGGCACGGCGGTTGGGCGCGTAAGGAATTAATGGCGGTGCCGCACTATGTCCGCCGCTGCGTGCATATGGTCGCTGC
GCATGAGCCGCGCGGCTCGTTTCCGCTCGATCTGATCGACTGTTCGTTGGAAGGGCGAGAGGAAATTGTGTATCCCGGCG
TTCACTCAGATGTGGGGGGTGGTTACGGACCAGCCGAGCAGGGACGAGGACGAGGCGATGCCGATAAGTTGTCGCAAGTT
CCACTCGTTGACATGTATAGAGCGGCACGTATCGCCGGCGTACCGCTCGATATACAAGGACCGGGCATCACGTCGGAAGC
GGCCGATGTATTTAAGATCTCCGCTGGACTCAAGCAAGCCTTTACTGCCTATGTCAAGGCAAGTGAGGGCTACTATTACG
CGAAGGAGCATGGGACAGCGGGTTTGATGCGAGCTCATTATGGTTTGTATCTGCGCTGGCGCAGGATGCGTCTCAAGGAT
ATGAGCTTGCAGCCGAGTTTCAAGGCTGCGCAGGCGAATTGTCCGCAAGACGCTATGGATATCGACAGTGCGAATAAGGA
ATTAAGGGCGGAATGGGAAGATCTGCTGGAGATTGAAAAGGAGGGAGGCCCGAGTGTGGCCCATTATGCAAAGAAGTTTG
GAGCGAAAGTGGCTCGAGACAATCCTAAAATTGTCGCATCCGTCTCGGCCGTTCTTTTGCCGGGGGTCATCGTCTTCAGT
ACTCGTCCTGAAGTTATTTACGGGGTGAGAAAGGCCGGTGATCGCGTGACAGAACTAGTCCGCGCCCAGCTTCAAGAAAA
ATGGGAGCAATGGCAGCAAGTCCGCAGCGACTGGAACATGGGCCCGCCCGAAGCGCCGATCAGCGCGCTGTACGACAACT
ACATGCACGACTCGCGAGCATGGTTCAAGCCGCTCGGCGATGACGACGACGTCTGGAACTACAAGCAGATCCAGGAGCTG
AAGTCGAAGCAAGCGAGCTTCGAGCGCGAGCACGCCGCATGGAGAAAACGCGCCGAAACGGGCGCGCCGGGGCCGTGGCA
GATCGCGCAGGCGATGAGTGCGGGGGCGTCCGGACTCGGGCCGATCGCAATGCAGCCCGAACCCGAACCCCGCTCCCCGC
TCACCGCCCAGCAAGCCGATTTGCTCAAGCGCTACGACGCCGCGATGCAGTCCGCGAAGCAGGCGCGCGCCGCGAAGGAC
CCGAACGCGCCGACGGACAGCGCCGTGCTCACCGATCCGAAAGTGACGGGCGGCCTCGCGTTGCAAACCAGCGGCCGCGA
GTTCTATTTCCTGTGGGGCTTCCTGCGCTGGCGAACCGTGTTCGTGAACGGCGTGCGCTGGGACCAGCCGCGCGTGCCGA
CAGTGCAGGAGGAAATGGAGGGCATGCGCATGCAGATGCAACGCCAGGTCGACATGAAGGGCATCGGCGTACTGTTCCAA
TGA