Detailed information of effector


Summary

Effector ID EFF00019 experimental
Effector type Tle
Cognate immunity protein IMU00080 experimental
Related T6SS (Type) T6SS00004 experimental (Type i1)
Strain Pseudomonas aeruginosa PAO1
Replicon chromosome
Sequence Protein sequence (1100 a.a.); Nucleotide sequence (3300 bp)
Description PldA; phospholipase
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PA3487 (Tle5)
Coordinates (Strand) 3902663..3905962 (+)
NCBI ID 15598683
RefSeq NC_002516
Uniprot ID Q9HYC2_PSEAE
KEGG ID pae:PA3487
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
PLDc PF00614.24 1.7e-07 164..189
PLDc PF00614.24 3.6e-06 851..877

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-1099 MLQKKPYNGLHEKELNQINQQDGSPCVAISAPGCFIKGSNLFSEKRAGNRVRFFTTGRDYFSDLASALDSASSSIFITGWQVNYDVLLDGRRSLWQCLRQALERSPALKVYVMPWLSPSGSLGTYDFETMLAVFQLNAGLEGGARAFCTPAIQQSDMQGLGVAFSHHQKSVVIDNRIGYVGGIDLAYGRRDDNDFSLDASGRRGNDAYNPGLPHLGWMAEDEHVSSMGLMMATLFDLSRPLASLTLHAPTLRLSPFPHIAASDEPLLSIPLAPSRARALNGAAYLSDLFRSPMLPSLQWLGRAYNSSKEGLDEGFERLDALRRQMVASSIRAIANLIADNLDALPIEPELERRLRAWLEELRTAALNLPEALRIKSLLLINQWMSETELGQVLTLISGKGFEDIPQNLSGKAGELAGSLFWTLHRLMQARAGGHQQPYRYLDEAPQPLASPDNARLAADQPRMPWQDVHCRIEGPSVYDLARNFIDRWNGQQAYLAKTPALQDTALVRSALEAVMKWLNSLAAAAGLENYLDEKRNLRLELDPPTPCWINAPEQLPQEPEVRRGGMTVQVLRSAAARMLEQEQAGRLGAGVNLPLQVGVSTEGVQSNCKDAMLLAISGAQQFIYIENQFFQSEFGKEGEVFKDLPLSGPMASLRDVGSLRRDFVVRIRLEEALEQRDLWLLDWAEVEKIAQEPGTEARQFLKSMLAMWGVNAQGWLTHKLGEAQHGLLNEIGEALARRIERAIQREHPFHVYLVLPVHPEGALNVPNIMHQVHLTQQSLVFGEQSLVKRIQRQMALKALEGKSDPAQAREIIERKDARGRPVYEQQDWSRYLTLLNLRTWAVLGGRVVTEQIYVHSKLLIADDRVAILGSANINDRSLQGERDSELAVMVRDSEPLTVRLDGKNDAIVGKAIHQLRVNLWKKHFGLSQGPGGFVKPASELSAYLSIPAAQEAWEAIQTLAKENTRAYERTFNFIPQNISQTQLQLTPEPPKGFEDGFPASIWPTWAYRKPGELRAGGQLMEPMPYQEIFWRSSNLTSVKTFPPPNGVSGFITALPTSWTRGERNDSGLNLSILAHQDSRSLPTQVAMNGDSSAQGKHRT



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9842 - -



  Protein sequence: 1100 a.a.    .

>EFF00019 NC_002516:3902663-3905962 [Pseudomonas aeruginosa PAO1]
MLQKKPYNGLHEKELNQINQQDGSPCVAISAPGCFIKGSNLFSEKRAGNRVRFFTTGRDYFSDLASALDSASSSIFITGW
QVNYDVLLDGRRSLWQCLRQALERSPALKVYVMPWLSPSGSLGTYDFETMLAVFQLNAGLEGGARAFCTPAIQQSDMQGL
GVAFSHHQKSVVIDNRIGYVGGIDLAYGRRDDNDFSLDASGRRGNDAYNPGLPHLGWMAEDEHVSSMGLMMATLFDLSRP
LASLTLHAPTLRLSPFPHIAASDEPLLSIPLAPSRARALNGAAYLSDLFRSPMLPSLQWLGRAYNSSKEGLDEGFERLDA
LRRQMVASSIRAIANLIADNLDALPIEPELERRLRAWLEELRTAALNLPEALRIKSLLLINQWMSETELGQVLTLISGKG
FEDIPQNLSGKAGELAGSLFWTLHRLMQARAGGHQQPYRYLDEAPQPLASPDNARLAADQPRMPWQDVHCRIEGPSVYDL
ARNFIDRWNGQQAYLAKTPALQDTALVRSALEAVMKWLNSLAAAAGLENYLDEKRNLRLELDPPTPCWINAPEQLPQEPE
VRRGGMTVQVLRSAAARMLEQEQAGRLGAGVNLPLQVGVSTEGVQSNCKDAMLLAISGAQQFIYIENQFFQSEFGKEGEV
FKDLPLSGPMASLRDVGSLRRDFVVRIRLEEALEQRDLWLLDWAEVEKIAQEPGTEARQFLKSMLAMWGVNAQGWLTHKL
GEAQHGLLNEIGEALARRIERAIQREHPFHVYLVLPVHPEGALNVPNIMHQVHLTQQSLVFGEQSLVKRIQRQMALKALE
GKSDPAQAREIIERKDARGRPVYEQQDWSRYLTLLNLRTWAVLGGRVVTEQIYVHSKLLIADDRVAILGSANINDRSLQG
ERDSELAVMVRDSEPLTVRLDGKNDAIVGKAIHQLRVNLWKKHFGLSQGPGGFVKPASELSAYLSIPAAQEAWEAIQTLA
KENTRAYERTFNFIPQNISQTQLQLTPEPPKGFEDGFPASIWPTWAYRKPGELRAGGQLMEPMPYQEIFWRSSNLTSVKT
FPPPNGVSGFITALPTSWTRGERNDSGLNLSILAHQDSRSLPTQVAMNGDSSAQGKHRT*

  Nucleotide sequence: 3300 bp    .

>EFF00019 NC_002516:3902663-3905962 [Pseudomonas aeruginosa PAO1]
ATGTTGCAGAAGAAGCCCTACAACGGCCTCCACGAAAAGGAACTCAACCAGATCAACCAGCAGGATGGCAGCCCCTGCGT
AGCCATTTCCGCACCGGGCTGTTTCATCAAGGGGTCCAACCTCTTTTCCGAAAAGCGGGCCGGTAACCGGGTCCGCTTCT
TCACCACCGGCCGGGACTACTTCAGCGACCTGGCCAGCGCCCTCGACAGCGCCAGTTCGAGCATCTTCATCACCGGCTGG
CAGGTCAACTACGACGTCCTCCTCGACGGCCGCCGCAGCCTCTGGCAGTGCCTGCGCCAGGCGCTGGAGCGCTCGCCCGC
GCTGAAGGTCTACGTGATGCCCTGGCTCAGCCCTTCCGGCAGCCTCGGCACCTATGACTTCGAAACCATGCTCGCGGTGT
TCCAGCTCAACGCCGGACTCGAGGGCGGCGCGCGCGCCTTCTGTACGCCGGCGATCCAGCAGAGCGACATGCAGGGACTG
GGCGTCGCCTTCTCCCACCACCAGAAATCCGTGGTGATCGACAACCGCATCGGCTATGTCGGCGGGATCGACCTTGCCTA
TGGCCGTCGCGACGACAACGATTTCAGCCTCGACGCCTCCGGGCGCCGGGGCAACGACGCCTATAATCCCGGCCTACCGC
ATCTTGGCTGGATGGCGGAGGACGAACACGTCAGCTCCATGGGCCTGATGATGGCCACCCTGTTCGACCTTTCCAGGCCG
CTCGCCAGCCTGACGCTGCATGCGCCCACCCTTCGCCTGTCGCCCTTCCCGCACATCGCCGCCAGCGACGAACCGCTGCT
GAGCATTCCCCTCGCACCCAGCCGCGCCCGCGCCCTCAACGGCGCCGCCTACCTTTCCGACCTGTTCCGCAGCCCGATGC
TGCCCTCCCTGCAATGGCTCGGCCGCGCCTACAACAGCTCGAAAGAAGGCCTGGACGAAGGCTTCGAACGGCTCGATGCG
CTCAGGCGGCAGATGGTCGCCAGCAGCATCCGCGCCATTGCCAACCTGATCGCCGACAACCTCGACGCCCTGCCCATCGA
GCCTGAACTCGAACGCCGCCTGCGCGCCTGGCTGGAGGAACTGCGCACGGCCGCGCTCAACCTGCCGGAAGCCCTGCGGA
TCAAGAGCCTGCTCCTGATCAACCAGTGGATGAGCGAAACCGAACTGGGCCAGGTCCTGACCCTGATCAGCGGCAAGGGC
TTCGAAGATATCCCGCAGAACCTGAGCGGCAAGGCCGGCGAGTTGGCCGGCTCGCTGTTCTGGACACTCCACAGGCTGAT
GCAGGCTCGCGCCGGAGGCCACCAGCAACCCTATCGCTACCTGGACGAAGCGCCTCAGCCATTGGCCTCGCCGGACAACG
CCCGGCTGGCCGCCGACCAGCCGCGCATGCCCTGGCAGGATGTGCATTGCCGCATCGAAGGGCCGTCGGTGTACGACCTG
GCGCGCAACTTCATCGACCGCTGGAACGGCCAGCAGGCCTACCTGGCCAAGACGCCGGCGCTACAGGATACGGCGCTGGT
ACGCAGCGCCCTGGAAGCCGTGATGAAGTGGCTGAACAGCCTGGCCGCCGCCGCGGGATTGGAGAACTACCTGGACGAGA
AGCGCAACCTCCGGCTCGAACTGGACCCACCCACGCCCTGCTGGATCAACGCGCCGGAACAGTTGCCGCAAGAGCCGGAG
GTGCGCCGCGGCGGCATGACCGTACAGGTACTGCGCAGCGCCGCGGCGCGCATGCTCGAACAGGAGCAGGCCGGCCGCCT
CGGCGCGGGAGTGAACCTGCCCTTGCAGGTCGGCGTCTCCACCGAAGGAGTCCAGAGCAACTGCAAGGACGCCATGCTCC
TGGCGATTTCCGGGGCGCAGCAGTTCATCTATATCGAGAACCAGTTCTTCCAGAGCGAGTTCGGCAAGGAAGGCGAAGTT
TTCAAGGATCTGCCCCTTTCAGGCCCCATGGCCAGTCTGCGCGACGTTGGCAGCCTGCGACGCGACTTCGTCGTCCGGAT
ACGCTTGGAGGAAGCCCTGGAGCAGCGCGACCTCTGGCTGCTGGACTGGGCCGAAGTGGAGAAGATCGCCCAGGAGCCTG
GCACCGAGGCCCGCCAGTTCCTCAAGTCGATGCTCGCCATGTGGGGCGTGAACGCCCAGGGCTGGCTCACCCACAAGCTC
GGCGAAGCCCAGCACGGCCTGCTCAACGAGATCGGCGAAGCCCTGGCGCGGCGCATCGAACGGGCCATCCAGCGCGAGCA
CCCGTTCCACGTCTACCTGGTCCTGCCGGTGCACCCGGAGGGCGCGCTGAACGTGCCGAACATCATGCACCAGGTGCACC
TGACCCAGCAGAGCCTGGTGTTCGGCGAACAGAGCCTGGTCAAGCGCATTCAGCGGCAGATGGCGCTCAAGGCCCTGGAA
GGCAAGTCCGACCCGGCCCAGGCCCGGGAAATCATCGAGCGCAAGGACGCTCGCGGTCGCCCGGTCTACGAACAGCAGGA
CTGGAGCCGCTACCTGACCCTGCTCAACCTGCGCACCTGGGCGGTGCTCGGCGGGCGGGTGGTCACCGAACAGATCTACG
TGCACAGCAAGCTGCTGATCGCCGACGACCGGGTGGCCATCCTCGGCAGCGCCAATATCAACGACCGCAGCCTGCAAGGC
GAGCGCGACTCCGAGCTGGCGGTGATGGTGCGCGACAGCGAGCCGCTGACGGTCAGGCTGGACGGCAAGAACGACGCCAT
CGTCGGCAAGGCCATCCACCAGTTGCGGGTGAATTTGTGGAAGAAGCATTTTGGCTTGAGCCAGGGGCCAGGCGGTTTCG
TCAAGCCGGCCAGCGAGTTGAGTGCTTATCTGTCCATCCCGGCGGCTCAAGAGGCCTGGGAAGCTATACAAACATTAGCC
AAGGAGAATACTCGTGCCTATGAACGGACTTTCAATTTTATTCCCCAAAATATCAGCCAGACTCAACTGCAACTGACTCC
AGAGCCGCCTAAAGGATTTGAGGACGGATTTCCCGCCTCCATATGGCCCACCTGGGCATACAGAAAACCTGGCGAGTTAA
GGGCGGGCGGACAACTGATGGAGCCGATGCCATATCAGGAAATCTTCTGGCGCTCATCTAATCTCACTTCGGTGAAAACC
TTCCCACCACCCAACGGGGTTTCCGGTTTCATCACGGCTCTACCAACCAGTTGGACCCGTGGTGAGCGCAATGATTCTGG
CTTGAATCTAAGCATCCTGGCACATCAGGACAGCAGATCGCTTCCCACCCAGGTCGCCATGAATGGAGATAGCTCGGCAC
AAGGAAAGCATCGCACATGA