Detailed information of effector


Summary

Effector ID EFF00017 experimental
Effector type Tge
Cognate immunity protein IMU00191 experimental
Related T6SS (Type) T6SS00003 experimental (Type i3)
Strain Pseudomonas aeruginosa PAO1
Replicon chromosome
Sequence Protein sequence (409 a.a.); Nucleotide sequence (1227 bp)
Description Tse3 (Tge1); muramidase
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PA3484 (Tse3, Tge1)
Coordinates (Strand) 3898278..3899504 (+)
NCBI ID 15598680
RefSeq NC_002516
Uniprot ID TSE3_PSEAE
KEGG ID pae:PA3484
PDB ID 4N88, 3WA5, 4LUQ, 4N7S, 4N80, 4M5E, 4M5F

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-408 MTATSDLIESLISYSWDDWQVTRQEARRVIAAIRNDNVPDATIAALDKSGSLIKLFQRVGPPELARSLIASIAGRTTMQRYQARNALIRSLINNPLGTQTDNWIYFPTITFFDICADLADAAGRLGFAAAGATGVASQAIQGPFSGVGATGVNPTDLPSIAFGDQLKLLNKDPATVTKYSNPLGDLGAYLSQLSPQDKLNQAQTLVGQPISTLFPDAYPGNPPSRAKVMSAAARKYDLTPQLIGAIILAEQRDQTRDEDAKDYQAAVSIKSANTSIGLGQVVVSTAIKYELFTDLLGQPVRRGLSRKAVATLLASDEFNIFATARYIRYVANLASQQDLRKLPKTRGAFPSIDLRAYAGNPRNWPRDNVRALASEYTSRPWDDNLSPGWPMFVDDAYATFLDPGMRFP



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9937 - -



  Protein sequence: 409 a.a.    .

>EFF00017 NC_002516:3898278-3899504 [Pseudomonas aeruginosa PAO1]
MTATSDLIESLISYSWDDWQVTRQEARRVIAAIRNDNVPDATIAALDKSGSLIKLFQRVGPPELARSLIASIAGRTTMQR
YQARNALIRSLINNPLGTQTDNWIYFPTITFFDICADLADAAGRLGFAAAGATGVASQAIQGPFSGVGATGVNPTDLPSI
AFGDQLKLLNKDPATVTKYSNPLGDLGAYLSQLSPQDKLNQAQTLVGQPISTLFPDAYPGNPPSRAKVMSAAARKYDLTP
QLIGAIILAEQRDQTRDEDAKDYQAAVSIKSANTSIGLGQVVVSTAIKYELFTDLLGQPVRRGLSRKAVATLLASDEFNI
FATARYIRYVANLASQQDLRKLPKTRGAFPSIDLRAYAGNPRNWPRDNVRALASEYTSRPWDDNLSPGWPMFVDDAYATF
LDPGMRFP*

  Nucleotide sequence: 1227 bp    .

>EFF00017 NC_002516:3898278-3899504 [Pseudomonas aeruginosa PAO1]
ATGACCGCCACCAGCGACCTGATCGAGTCACTGATTTCCTATAGCTGGGACGACTGGCAGGTGACCCGCCAGGAAGCCCG
CCGGGTGATCGCCGCGATCCGCAACGACAACGTGCCCGATGCGACCATCGCCGCACTCGACAAGAGCGGCTCGCTGATCA
AGCTGTTCCAGCGGGTGGGCCCGCCGGAACTGGCGCGCTCGCTGATCGCCAGCATCGCCGGGCGCACCACCATGCAGCGC
TACCAGGCACGCAATGCCTTGATCCGCAGCCTGATCAATAATCCCCTGGGCACCCAGACCGACAACTGGATCTACTTCCC
CACCATCACCTTCTTCGACATCTGCGCCGACCTCGCCGACGCCGCTGGCCGCCTGGGCTTCGCCGCGGCCGGCGCCACCG
GGGTGGCCAGCCAGGCGATCCAGGGTCCGTTCAGCGGGGTCGGCGCCACCGGCGTCAATCCGACCGACCTGCCGTCCATT
GCCTTCGGCGACCAGCTCAAGCTGCTCAACAAGGACCCGGCGACCGTCACCAAGTACAGCAACCCGCTCGGCGACCTGGG
CGCCTACCTGAGCCAGCTTTCGCCGCAAGACAAGCTGAACCAGGCACAGACGCTGGTCGGCCAGCCGATCAGCACGCTGT
TCCCCGACGCCTATCCGGGCAACCCGCCGTCGCGGGCCAAGGTCATGTCCGCGGCCGCGCGCAAGTACGACCTGACGCCG
CAACTGATCGGCGCGATCATCCTCGCCGAGCAGCGTGACCAGACCCGCGACGAAGACGCCAAGGACTATCAGGCGGCAGT
CAGCATCAAGAGCGCCAACACCTCCATCGGCCTCGGCCAGGTGGTGGTCTCCACCGCGATCAAGTACGAGCTGTTCACCG
ACCTGCTCGGCCAGCCGGTGCGCCGCGGTCTGTCGCGCAAGGCGGTCGCCACCCTGCTGGCTTCCGACGAATTCAACATC
TTCGCCACCGCCCGTTACATCCGCTACGTCGCCAACCTCGCGTCGCAACAGGACCTGCGCAAGTTGCCGAAGACCCGCGG
CGCATTTCCCTCCATCGATCTCCGCGCCTACGCCGGCAATCCGCGCAACTGGCCGCGGGACAATGTCCGCGCGCTGGCCT
CGGAATACACCTCGCGGCCCTGGGACGACAACCTGTCGCCGGGCTGGCCGATGTTCGTCGACGATGCCTACGCCACCTTC
CTCGACCCTGGAATGAGGTTCCCATGA