Detailed information of effector


Summary

Effector ID EFF00016 experimental
Effector type Tse
Cognate immunity protein IMU00107 experimental
Related T6SS (Type) T6SS00003 experimental (Type i3)
Strain Pseudomonas aeruginosa PAO1
Replicon chromosome
Sequence Protein sequence (159 a.a.); Nucleotide sequence (477 bp)
Description Tse2; cytoplasmic-acting toxin
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PA2702 (Tse2)
Coordinates (Strand) 3056890..3057366 (+)
NCBI ID 15597898
RefSeq NC_002516
Uniprot ID TSE2_PSEAE
KEGG ID pae:PA2702
PDB ID 5AKO

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
ADPRTs_Tse2 PF18648.3 1.2e-61 7..152

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-158 MSYDYEKTSLTLYRAVFKANYDGDVGRYLHPDKELAEAAEVAPLLHPTFDSPNTPGVPARAPDIVAGRDGLYAPDTGGTSVFDRAGVLRRADGDFVIPDGTDIPPDLKVKQDSYNKRLQATHYTIMPAKPMYREVLMGQLDNFVRNAIRRQWEKARGL



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9889 - -



  Protein sequence: 159 a.a.    .

>EFF00016 NC_002516:3056890-3057366 [Pseudomonas aeruginosa PAO1]
MSYDYEKTSLTLYRAVFKANYDGDVGRYLHPDKELAEAAEVAPLLHPTFDSPNTPGVPARAPDIVAGRDGLYAPDTGGTS
VFDRAGVLRRADGDFVIPDGTDIPPDLKVKQDSYNKRLQATHYTIMPAKPMYREVLMGQLDNFVRNAIRRQWEKARGL*

  Nucleotide sequence: 477 bp    .

>EFF00016 NC_002516:3056890-3057366 [Pseudomonas aeruginosa PAO1]
ATGTCCTACGACTACGAGAAAACCAGCCTCACCCTCTACCGGGCGGTATTCAAGGCCAACTACGACGGCGACGTCGGTCG
CTACCTGCATCCCGACAAGGAACTCGCCGAGGCTGCGGAAGTCGCCCCGCTGCTGCATCCGACCTTCGACAGCCCCAACA
CCCCTGGCGTCCCCGCCCGCGCGCCGGACATCGTCGCCGGCCGCGACGGCCTCTACGCCCCGGACACCGGCGGCACCTCG
GTGTTCGACCGCGCCGGCGTGCTGCGCCGCGCCGACGGCGACTTCGTGATACCCGACGGCACCGACATCCCGCCGGACCT
TAAGGTGAAGCAGGACAGCTACAACAAGCGCCTGCAAGCCACCCACTACACCATCATGCCGGCCAAGCCGATGTACCGGG
AGGTCCTCATGGGCCAACTGGACAACTTCGTGCGCAACGCCATCCGCCGCCAATGGGAAAAAGCCCGCGGGCTCTAG