Detailed information of accessory protein


Summary

Accessory protein ID ACP26818 experimental
Type adaptor
Related T6SS (Type) T6SS00050 (Type i1)
Strain Photorhabdus laumondii subsp. laumondii TTO1
Replicon chromosome
Related structure protein -
Related effector Plu0353 (Tre23)
Description A Strep-tag pull-down experiment was performed from E. coli cells producing full-length FLAG- tagged Rhs, His-tagged VgrG and the Strep-tagged EagR chaperone and showed EagR is the bridge of VgrG and Rhs effector.
Reference [1] Jur─Śnas D, Payelleville A, Roghanian M, et al. Photorhabdus antibacterial Rhs polymorphic toxin inhibits translation through ADP-ribosylation of 23S ribosomal RNA. Nucleic Acids Res. 2021 Aug 20;49(14):8384-8395. doi: 10.1093/nar/gkab608. PMID: 34255843
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) Plu0354 (EagR)
Coordinates (Strand) 372357..372677 (-)
NCBI ID WP_011144744.1
RefSeq NC_005126
Uniprot ID A0A6L9JXU2_PHOLM, Q7N9I1_PHOLL
KEGG ID plu:plu0352, plum:A4R40_01715
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-106 MKHESIQLAREEVNAIIKLILYIKFECEDPGTLIYSSSPLINSALEKMLNMYGYKDDWDKVFSKFLEADKNFVIKRVEYLEKHENSPLDEGIKQQILSNHAYPYKW



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9939 - -



  Protein sequence: 107 a.a.    

>ACP26818 NC_005126:c372677-372357 [Photorhabdus laumondii subsp. laumondii TTO1]
MKHESIQLAREEVNAIIKLILYIKFECEDPGTLIYSSSPLINSALEKMLNMYGYKDDWDKVFSKFLEADKNFVIKRVEYL
EKHENSPLDEGIKQQILSNHAYPYKW*

  Nucleotide sequence: 321 bp    

>ACP26818 NC_005126:c372677-372357 [Photorhabdus laumondii subsp. laumondii TTO1]
ATGAAGCACGAATCTATTCAATTAGCAAGGGAAGAGGTGAATGCAATAATCAAGCTGATCCTTTACATAAAGTTTGAATG
TGAAGATCCTGGAACATTGATATATTCAAGTAGTCCTTTGATAAATTCAGCATTGGAAAAAATGTTGAATATGTATGGTT
ATAAGGATGATTGGGATAAAGTTTTTTCAAAATTTCTAGAAGCAGATAAGAATTTTGTAATCAAAAGAGTCGAATATTTA
GAAAAACATGAAAATAGTCCTCTTGATGAGGGAATTAAGCAGCAAATCTTATCAAATCATGCATATCCATATAAGTGGTA
G