Detailed information of accessory protein


Summary

Accessory protein ID ACP00037 experimental
Type chaperone
Related T6SS (Type) T6SS00931 (Type i4b)
Strain Escherichia coli 042
Replicon chromosome
Related structure protein TssL
Related effector -
Description TssL insertion is catalyzed by YidC and modulated by the Hsp70 homologue DnaK
Reference [1] Aschtgen MS, Zoued A, Lloub├Ęs R, et al. The C-tail anchored TssL subunit, an essential protein of the enteroaggregative Escherichia coli Sci-1 Type VI secretion system, is inserted by YidC. Microbiologyopen. 2012 Mar;1(1):71-82. doi: 10.1002/mbo3.9. PMID: 22950014
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) EC042_RS00085 (dnaK)
Coordinates (Strand) 13600..15516 (+)
NCBI ID 446438280
RefSeq NC_017626
Uniprot ID DNAK_ECO24, DNAK_ECO57, DNAK_ECOK1, DNAK_ECOL5, DNAK_ECOL6, DNAK_ECOLC, DNAK_ECOLI, DNAK_ECOUT, DNAK_SHIDS, A0A023YRN2_ECOLR, A0A026V909_ECOLX, A0A028AGC2_ECOLX, A0A028DMW1_ECOLX, A0A029IET6_ECOLX, A0A029J3I9_ECOLX, A0A069XJD6_ECOLX, A0A070FAW9_ECOLX, A0A070SUQ2_ECOLX, A0A070UWV8_ECOLX, A0A073G1N9_ECOLX, A0A073H093_ECOLX, A0A073UBB3_ECOLX, A0A074I9L8_ECOLX, A0A080GHB1_ECOLX, A0A080I6E6_ECOLX, A0A0A0F4Y9_ECOLX, A0A0E0TT00_ECOLX, A0A0E0V190_ECOLX, A0A0E0Y423_ECO1C, A0A0E1LXB0_ECOLX, A0A0E1SYF6_ECOLX, A0A0E2LA25_ECOU3, A0A0H3EET3_ECO8N, A0A0H3MHN8_ECO7I, A0A0H3PVS0_ECO5C, A0A0I1M082_SHISO, A0A0K9TJA2_ECOLX, A0A140NFV3_ECOBD, A0A181WY94_KLEOX, A0A1Q8MQG3_SHIBO, A0A1X3ICD2_ECOLX, A0A1X3IGH8_ECOLX, A0A1X3J7J6_ECOLX, A0A1X3JMM9_ECOLX, A0A1X3K1M4_9ESCH, A0A1X3KNF7_ECOLX, A0A1X3KTL0_ECOLX, A0A1X3L924_ECOLX, A0A1X3M2N4_ECOLX, A0A1Z3UVH7_ECOLX, A0A2D0NL43_ECOLX, A0A2S8D8J7_SHIDY, B1LFU4_ECOSM, B6HZ10_ECOSE, B7L4D8_ECO55, B7LVP6_ESCF3, B7M9S6_ECO45, B7MNM1_ECO81, B7N7N8_ECOLU, B7UI59_ECO27, C3TRK2_ECOLX, C8UFY8_ECO1A, D3H398_ECO44, D3QV97_ECOCB, D6I4R2_ECOLX, D6IHX4_ECOLX, D6J6E1_ECOLX, D7X397_ECOLX, D7Y6P8_ECOM1, D7ZAT4_ECOLX, D8ACD1_ECOMS, D8E5S6_ECOLX, E0IZ11_ECOLW, E3PBA3_ECOH1, E9TCG6_ECOLX, E9XQW5_ECOLX, E9YZ68_ECOLX, F4NLG8_ECOLX, F4SF12_ECOLX, F4STF3_ECOLX, F4T9I3_ECOLX, F4VN95_ECOLX, I2RP96_ECOLX, I2RTY6_ECOLX, I2SL33_ECOLX, I2UPJ7_ECOLX, I2WSD7_ECOLX, I4T5X7_ECOLX, K4VB12_ECOLX, K4Y6X5_ECOLX, L3BUY2_ECOLX, L3PG43_ECOLX, L4JGN8_ECOLX, L4W5U7_ECOLX, M9GGC4_ECOLX, S0Y2Z2_ECOLX, S0ZZ15_ECOLX, S1CNJ8_ECOLX, S1EDG5_ECOLX, S1H8V3_ECOLX, S1I8M1_ECOLX, S1JCM7_ECOLX, S1PDC5_ECOLX, T6MLU5_ECOLX, T9D9H6_ECOLX, T9UGU1_ECOLX, U9XRZ1_ECOLX, U9Y5I2_ECOLX, V0ZDL7_ECOLX, V6G0R2_ECOLX, V8K7R3_ECOLX, W0ASJ3_9ESCH, W8ZCX8_ECOLX
KEGG ID ecm:EcSMS35_0012, ecos:EC958_0146, ecz:ECS88_0014, eum:ECUMN_0014, eci:UTI89_C0016, ecq:ECED1_0013, eok:G2583_0014, eco:b0014, eal:EAKF1_ch1410c, ecl:EcolC_3642, eun:UMNK88_12, ece:Z0014, sdy:SDY_0013, ecg:E2348C_0014, ecw:EcE24377A_0014, ebd:ECBD_3605, elh:ETEC_0013, ecj:JW0013, elw:ECW_m0014, elo:EC042_0014, ecy:ECSE_0013, ecp:ECP_0014, eoi:ECO111_0013, ecc:c0019, eln:NRG857_00075, eck:EC55989_0014, ecs:ECs0014, eoc:CE10_0012, esl:O3K_21475, ecv:APECO1_1965, ect:ECIAI39_0013, efe:EFER_0010
PDB ID 4HY9, 1DKG, 4EZP, 4R5J, 1DKX, 4JNE, 4B9Q, 4JWC, 4JWI, 4JNF, 4EZR, 5OOW, 4EZX, 3DPP, 4HYB, 1Q5L, 4R5I, 7JN9, 4EZT, 4F00, 4R5K, 1DKZ, 3DPO, 4E81, 4EZU, 3DPQ, 4EZW, 1DG4, 4EZY, 7JNG, 4EZN, 1BPR, 4EZO, 4JN4, 7JNE, 4EZQ, 4R5G, 4EZZ, 4F01, 4R5L, 1DKY, 4JWD, 2KHO, 4EZS, 3QNJ, 5NRO, 7JML, 7JN8, 7JMZ, 4EZV, 2BPR, 4JWE, 7JM8, 7JMM

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
HSP70 PF00012.22 3.2e-271 4..602

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-638 MGKIIGIDLGTTNSCVAIMDGTTPRVLENAEGDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPFKIIAADNGDAWVEVKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKGTGNRTIAVYDLGGGTFDISIIEIDEVDGEKTFEVLATNGDTHLGGEDFDSRLINYLVEEFKKDQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADATGPKHMNIKVTRAKLESLVEDLVNRSIEPLKVALQDAGLSVSDIDDVILVGGQTRMPMVQKKVAEFFGKEPRKDVNPDEAVAIGAAVQGGVLTGDVKDVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQHAQQQTAGADASANNAKDDDVVDAEFEEVKDKK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9174 - -



  Protein sequence: 639 a.a.    

>ACP00037 NC_017626:13600-15516 [Escherichia coli 042]
MGKIIGIDLGTTNSCVAIMDGTTPRVLENAEGDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDE
EVQRDVSIMPFKIIAADNGDAWVEVKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRI
AGLEVKRIINEPTAAALAYGLDKGTGNRTIAVYDLGGGTFDISIIEIDEVDGEKTFEVLATNGDTHLGGEDFDSRLINYL
VEEFKKDQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADATGPKHMNIKVTRAKLESLVEDLVNRSIEPL
KVALQDAGLSVSDIDDVILVGGQTRMPMVQKKVAEFFGKEPRKDVNPDEAVAIGAAVQGGVLTGDVKDVLLLDVTPLSLG
IETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDA
DGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPAD
DKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQHAQQQTAGADASANNAKDDDVVDAEFEEVKDKK*

  Nucleotide sequence: 1917 bp    

>ACP00037 NC_017626:13600-15516 [Escherichia coli 042]
ATGGGTAAAATAATTGGTATCGACTTGGGTACTACCAACTCTTGTGTAGCGATTATGGATGGCACCACTCCTCGTGTGCT
GGAGAATGCCGAAGGCGATCGCACCACGCCTTCTATCATTGCCTATACCCAGGATGGTGAAACTCTGGTTGGTCAGCCGG
CTAAACGTCAGGCAGTGACGAACCCGCAAAACACCCTGTTTGCGATTAAACGCCTGATTGGCCGCCGCTTCCAGGACGAA
GAAGTACAGCGTGATGTTTCCATCATGCCGTTCAAAATTATTGCTGCTGATAACGGCGACGCATGGGTCGAAGTTAAAGG
CCAGAAAATGGCACCGCCGCAGATTTCTGCTGAAGTGCTGAAAAAAATGAAGAAAACCGCTGAAGATTACCTGGGTGAAC
CGGTAACTGAAGCTGTTATCACCGTACCGGCATACTTTAACGATGCTCAGCGTCAGGCAACCAAAGACGCAGGCCGTATC
GCTGGTCTCGAAGTAAAACGTATCATCAACGAACCGACCGCAGCTGCGCTGGCTTACGGTCTGGACAAAGGTACTGGCAA
CCGTACTATCGCGGTTTATGACCTGGGTGGTGGTACTTTCGATATTTCTATTATTGAAATCGACGAAGTTGACGGCGAAA
AAACCTTCGAAGTTCTGGCAACCAACGGTGATACCCACCTGGGTGGTGAAGACTTCGACAGCCGTCTGATCAACTATCTG
GTTGAAGAATTCAAGAAAGATCAGGGCATTGACCTGCGCAACGATCCGCTGGCAATGCAGCGCCTGAAAGAAGCGGCAGA
AAAAGCGAAAATCGAACTGTCTTCCGCTCAGCAGACCGACGTTAACCTGCCGTACATCACTGCAGACGCGACCGGTCCGA
AACACATGAACATCAAAGTGACTCGTGCGAAACTGGAAAGCCTGGTTGAAGATCTGGTTAACCGTTCCATCGAGCCGCTG
AAAGTTGCACTGCAGGACGCTGGCCTGTCTGTATCTGATATCGACGACGTTATCCTCGTTGGTGGTCAGACTCGTATGCC
AATGGTTCAGAAGAAAGTTGCTGAGTTCTTTGGTAAAGAGCCGCGTAAAGACGTTAACCCGGACGAAGCTGTAGCAATCG
GTGCTGCTGTTCAGGGCGGTGTTCTGACTGGTGACGTAAAAGACGTACTGCTGCTGGACGTTACCCCGCTGTCTCTGGGT
ATCGAAACCATGGGCGGTGTGATGACGACGCTGATCGCGAAAAACACCACTATCCCAACCAAGCACAGCCAGGTGTTCTC
TACCGCTGAAGACAACCAGTCTGCGGTAACCATCCATGTGCTGCAGGGTGAACGTAAACGTGCGGCTGATAACAAATCTC
TGGGTCAGTTCAACCTGGATGGTATCAACCCGGCACCGCGCGGCATGCCGCAGATCGAAGTTACCTTCGATATCGATGCT
GACGGTATCCTGCACGTTTCCGCGAAAGATAAAAACAGCGGTAAAGAGCAGAAGATCACCATCAAGGCGTCTTCTGGTCT
GAACGAAGATGAAATCCAGAAAATGGTACGCGACGCAGAAGCTAACGCCGAAGCTGACCGTAAGTTTGAAGAGCTGGTAC
AGACTCGCAACCAGGGCGACCATCTGCTGCACAGCACCCGTAAGCAGGTTGAAGAAGCAGGCGACAAACTGCCGGCTGAC
GACAAAACTGCTATCGAGTCTGCGCTGACTGCACTGGAAACTGCTCTGAAAGGTGAAGACAAAGCCGCTATCGAAGCGAA
AATGCAGGAACTGGCACAGGTTTCCCAGAAACTGATGGAAATCGCCCAGCAGCAACATGCCCAGCAGCAGACTGCCGGTG
CTGATGCTTCTGCAAACAACGCGAAAGATGACGATGTTGTCGACGCTGAATTTGAAGAAGTCAAAGACAAAAAATAA