Detailed information of component protein


Summary

Component ID T6CP005148
Component protein type TssL
T6SS ID (Type) T6SS00464 experimental (Type i4b)
Strain Escherichia coli 042
Replicon chromosome
Sequence Protein sequence (197 a.a.); Nucleotide sequence (591 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) EC042_RS24425
Coordinate (Strand) 4904890..4905480 (+)
NCBI ID WP_001028111.1
RefSeq NC_017626
Uniprot ID A0A3J8YF41_ECOLX, D3GV02_ECO44
KEGG ID elo:EC042_4575
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DotU PF09850.11 3.6e-31 3..194

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-172 VNIVECYMPVFKLISSVRVFPEEYSDYDSTRKNIINTVEEAVRNSEKMSLSDSELDAAFYAVIVMLDEAILCSELPCRKEWRDNLLQIKYFGHSTGGVEFFYKLDKVIESGSQAGWVFLLCLLLGFRGKYSVGSNDEINNYISRLRRQCELNVAIDEGNNISLREKKYKSSR
Transmembrane helix 173-195 LGFYLLLVGIVAVYFVVLSMIYM
Outside 196-196 R



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9766 - -



  Protein sequence: 197 a.a.    

>T6CP005148 NC_017626:4904890-4905480 [Escherichia coli 042] [TssL]
VNIVECYMPVFKLISSVRVFPEEYSDYDSTRKNIINTVEEAVRNSEKMSLSDSELDAAFYAVIVMLDEAILCSELPCRKE
WRDNLLQIKYFGHSTGGVEFFYKLDKVIESGSQAGWVFLLCLLLGFRGKYSVGSNDEINNYISRLRRQCELNVAIDEGNN
ISLREKKYKSSRLGFYLLLVGIVAVYFVVLSMIYMR*

  Nucleotide sequence: 591 bp    

>T6CP005148 NC_017626:4904890-4905480 [Escherichia coli 042] [TssL]
GTGAATATTGTTGAATGCTATATGCCAGTATTTAAACTCATATCATCTGTCAGAGTTTTCCCTGAAGAATATAGTGATTA
CGACAGTACTAGAAAGAATATAATTAACACTGTTGAGGAGGCTGTTCGCAATAGTGAAAAAATGTCGTTGAGTGACAGCG
AACTTGATGCGGCATTTTATGCTGTAATCGTCATGCTTGATGAGGCAATATTGTGTTCAGAGCTTCCCTGTAGAAAAGAA
TGGCGTGATAATCTTTTGCAGATAAAATATTTCGGACACTCCACTGGGGGGGTCGAGTTCTTTTATAAACTTGATAAAGT
CATCGAATCGGGAAGTCAGGCTGGATGGGTCTTTCTCCTGTGCCTGTTACTGGGTTTCAGAGGTAAATATTCCGTGGGTA
GTAATGATGAAATCAATAATTATATATCGAGGCTGAGGCGACAATGTGAATTGAATGTTGCAATCGACGAAGGAAACAAT
ATTTCACTCAGGGAAAAAAAGTATAAATCATCGAGGCTTGGTTTCTATTTATTACTTGTAGGTATTGTTGCTGTCTATTT
TGTGGTTTTATCCATGATTTATATGAGATGA