Detailed information of accessory protein


Summary

Accessory protein ID ACP00036 experimental
Type chaperone
Related T6SS (Type) T6SS00931 (Type i4b)
Strain Escherichia coli 042
Replicon chromosome
Related structure protein TssL
Related effector -
Description TssL insertion is catalyzed by YidC and modulated by the Hsp70 homologue DnaK
Reference [1] Aschtgen MS, Zoued A, Lloub├Ęs R, et al. The C-tail anchored TssL subunit, an essential protein of the enteroaggregative Escherichia coli Sci-1 Type VI secretion system, is inserted by YidC. Microbiologyopen. 2012 Mar;1(1):71-82. doi: 10.1002/mbo3.9. PMID: 22950014
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) EC042_RS21585 (yidC)
Coordinates (Strand) 4320019..4321665 (+)
NCBI ID 446300403
RefSeq NC_017626
Uniprot ID YIDC_ECO27, YIDC_ECO45, YIDC_ECO55, YIDC_ECO57, YIDC_ECO5E, YIDC_ECO7I, YIDC_ECO81, YIDC_ECO8A, YIDC_ECOHS, YIDC_ECOK1, YIDC_ECOL5, YIDC_ECOL6, YIDC_ECOLC, YIDC_ECOLU, YIDC_ECOSE, YIDC_ECOSM, YIDC_ECOUT, A0A026V0H3_ECOLX, A0A028AEV0_ECOLX, A0A028DQR9_ECOLX, A0A029HGJ6_ECOLX, A0A029IHH0_ECOLX, A0A073H1K0_ECOLX, A0A080FP47_ECOLX, A0A0E0VBX3_ECOLX, A0A0E0YA15_ECO1C, A0A0E2LDY1_ECOU3, A0A0H3ENY7_ECO8N, A0A0H3PZ29_ECO5C, A0A0I2I989_SHISO, A0A0K9TF34_ECOLX, A0A170I7G0_KLEOX, A0A192CFE5_ECOLX, A0A1X3I0K0_ECOLX, A0A1X3K488_ECOLX, A0A1X3KWV1_ECOLX, A0A1X3LR49_ECOLX, A0A1Z3UYC0_ECOLX, A0A2D0P0Q3_ECOLX, D3H331_ECO44, D3QW97_ECOCB, D6JH37_ECOLX, D7X1B2_ECOLX, D7XJH7_ECOLX, D7ZCR9_ECOLX, D8AG71_ECOMS, D8ECC0_ECOLX, E0J324_ECOLW, E1JC74_ECOLX, E3XRR4_ECOLX, E6BME2_ECOLX, E9TGH7_ECOLX, E9XS78_ECOLX, F4NPX2_ECOLX, F4T5S1_ECOLX, F4VL26_ECOLX, H4LJE3_ECOLX, I2SRT6_ECOLX, I4S2S5_ECOLX, J7RWJ6_ECOLX, K4XMS9_ECOLX, L4IVT2_ECOLX, S0XN46_ECOLX, S0YKC5_ECOLX, S1I2V9_ECOLX, S1P6R5_ECOLX, T6LC73_ECOLX, U9XF98_ECOLX, U9XPC7_ECOLX, V0AE92_ECOLX, V0T1P1_ECOLX, V0V877_ECOLX, V0XLX2_ECOLX, V0ZDH7_ECOLX, V8KJM0_ECOLX, W8ZR30_ECOLX
KEGG ID ecp:ECP_3906, ecf:ECH74115_5135, ecc:c4629, ecos:EC958_4179, eck:EC55989_4176, ecy:ECSE_3991, ecq:ECED1_4397, eoc:CE10_4350, eln:NRG857_18460, ecs:ECs4640, ece:Z5197, ecm:EcSMS35_4072, ecr:ECIAI1_3885, eci:UTI89_C4258, ecz:ECS88_4129, elo:EC042_4062, ecg:E2348C_4016, eok:G2583_4494, ect:ECIAI39_4310, esl:O3K_25320, elw:ECW_m4004, ecl:EcolC_4289, ecx:EcHS_A3919, eum:ECUMN_4237, ecv:APECO1_2754
PDB ID 3WVF

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
YidC_periplas PF14849.8 1.9e-88 61..343
60KD_IMP PF02096.22 3e-60 354..533

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-6 MDSQRN
Transmembrane helix 7-24 LLVIALLFVSFMIWQAWE
Outside 25-345 QDKNPQPQAQQTTQTTTTAAGSAADQGVPASGQGKLISVKTDVLDLTINTRGGDVEQALLPAYPKELNSTQPFQLLETSPQFIYQAQSGLTGRDGPDNPANGPRPLYNVEKDAYVLAEGQNELQVPMTYTDAAGNTFTKTFVLKRGDYAVNVNYNVQNAGEKPLEISTFGQLKQSITLPPHLDTGSSNFALHTFRGAAYSTPDEKYEKYKFDTIADNENLNISSKGGWVAMLQQYFATAWIPHNDGTNNFYTANLGNGIAAIGYKSQPVLVQPGQTGAMNSTLWVGPEIQDKMAAVAPHLDLTVDYGWLWFISQPLFKLLK
Transmembrane helix 346-368 WIHSFVGNWGFSIIIITFIVRGI
Inside 369-418 MYPLTKAQYTSMAKMRMLQPKIQAMRERLGDDKQRISQEMMALYKAEKVN
Transmembrane helix 419-441 PLGGCFPLLIQMPIFLALYYMLM
Outside 442-496 GSVELRQAPFALWIHDLSAQDPYYILPILMGVTMFFIQKMSPTTVTDPMQQKIMT
Transmembrane helix 497-519 FMPVIFTVFFLWFPSGLVLYYIV
Inside 520-548 SNLVTIIQQQLIYRGLEKRGLHSREKKKS



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.6431 - -



  Protein sequence: 549 a.a.    

>ACP00036 NC_017626:4320019-4321665 [Escherichia coli 042]
MDSQRNLLVIALLFVSFMIWQAWEQDKNPQPQAQQTTQTTTTAAGSAADQGVPASGQGKLISVKTDVLDLTINTRGGDVE
QALLPAYPKELNSTQPFQLLETSPQFIYQAQSGLTGRDGPDNPANGPRPLYNVEKDAYVLAEGQNELQVPMTYTDAAGNT
FTKTFVLKRGDYAVNVNYNVQNAGEKPLEISTFGQLKQSITLPPHLDTGSSNFALHTFRGAAYSTPDEKYEKYKFDTIAD
NENLNISSKGGWVAMLQQYFATAWIPHNDGTNNFYTANLGNGIAAIGYKSQPVLVQPGQTGAMNSTLWVGPEIQDKMAAV
APHLDLTVDYGWLWFISQPLFKLLKWIHSFVGNWGFSIIIITFIVRGIMYPLTKAQYTSMAKMRMLQPKIQAMRERLGDD
KQRISQEMMALYKAEKVNPLGGCFPLLIQMPIFLALYYMLMGSVELRQAPFALWIHDLSAQDPYYILPILMGVTMFFIQK
MSPTTVTDPMQQKIMTFMPVIFTVFFLWFPSGLVLYYIVSNLVTIIQQQLIYRGLEKRGLHSREKKKS*

  Nucleotide sequence: 1647 bp    

>ACP00036 NC_017626:4320019-4321665 [Escherichia coli 042]
ATGGATTCGCAACGCAATCTTTTAGTCATCGCTTTGCTGTTCGTGTCTTTCATGATCTGGCAAGCCTGGGAGCAGGATAA
AAACCCGCAACCTCAGGCCCAACAGACCACGCAGACAACGACCACCGCAGCGGGTAGCGCCGCCGACCAGGGCGTACCGG
CCAGTGGCCAGGGGAAACTGATCTCGGTTAAGACCGACGTGCTTGATCTGACCATCAACACCCGTGGTGGTGATGTTGAG
CAAGCTCTGCTGCCTGCTTACCCGAAAGAGCTGAACTCTACCCAGCCGTTCCAGCTGCTGGAAACTTCACCGCAGTTTAT
TTATCAGGCACAGAGCGGTCTGACCGGTCGTGATGGCCCGGATAACCCGGCTAACGGCCCGCGTCCGCTGTATAACGTTG
AAAAAGACGCTTATGTGCTGGCTGAAGGTCAAAACGAACTGCAGGTGCCGATGACGTATACCGACGCGGCAGGCAACACG
TTTACCAAAACGTTTGTCCTGAAACGTGGTGATTACGCTGTCAACGTCAACTACAACGTGCAGAACGCTGGCGAGAAACC
GCTGGAAATCTCCACCTTTGGTCAGTTGAAGCAATCCATCACTCTGCCACCGCATCTCGATACCGGAAGCAGCAACTTCG
CACTGCACACCTTCCGTGGCGCGGCGTACTCCACGCCTGACGAGAAGTACGAGAAATACAAGTTCGATACCATTGCCGAT
AACGAAAACCTGAACATCTCTTCGAAAGGTGGTTGGGTGGCAATGCTGCAACAGTATTTCGCGACGGCGTGGATCCCGCA
TAACGACGGTACCAATAACTTCTATACCGCTAATCTGGGTAACGGCATCGCCGCTATCGGCTACAAGTCTCAACCGGTAC
TGGTTCAGCCTGGTCAGACTGGCGCGATGAACAGCACCCTGTGGGTTGGCCCGGAAATCCAGGACAAAATGGCAGCTGTT
GCTCCGCACCTGGATCTGACCGTTGATTACGGTTGGTTGTGGTTCATCTCTCAGCCGCTGTTCAAACTGCTGAAATGGAT
CCATAGCTTTGTGGGTAACTGGGGCTTCTCCATTATCATCATCACCTTTATCGTTCGTGGCATCATGTACCCGCTGACCA
AAGCGCAGTACACCTCCATGGCGAAGATGCGTATGCTGCAGCCGAAGATTCAGGCAATGCGTGAGCGTCTGGGCGATGAC
AAACAGCGCATCAGTCAGGAAATGATGGCGCTGTACAAAGCTGAGAAGGTTAACCCGCTGGGCGGCTGCTTCCCGCTGCT
GATCCAGATGCCAATCTTCCTGGCGTTGTACTACATGCTGATGGGTTCCGTTGAACTGCGTCAGGCACCGTTTGCACTGT
GGATCCACGACCTGTCTGCACAGGACCCGTACTACATCCTGCCGATCCTGATGGGCGTAACGATGTTCTTCATTCAGAAG
ATGTCGCCGACCACTGTGACCGACCCGATGCAGCAGAAGATCATGACCTTTATGCCGGTCATCTTCACCGTGTTCTTCCT
GTGGTTCCCGTCAGGTCTGGTGCTGTACTATATCGTCAGCAACCTGGTAACCATTATTCAGCAGCAGCTGATTTACCGTG
GTCTGGAAAAACGTGGCCTGCATAGCCGCGAGAAGAAAAAATCCTGA