Detailed information of accessory protein


Summary

Accessory protein ID ACP00034 experimental
Type structure affiliated protein
Related T6SS (Type) T6SS00931 (Type i4b)
Strain Escherichia coli 042
Replicon chromosome
Related structure protein TssM
Related effector -
Description MltE is recruited and activated by TssM, and local peptidoglycan hydrolysis by MltE is not required for formation of TssJLM heterotrimers but rather is necessary for assembly of the TssJLM core complex.
Reference [1] Byun B, Mahasenan KV, Dik DA, et al. Mechanism of the Escherichia coli MltE lytic transglycosylase, the cell-wall-penetrating enzyme for Type VI secretion system assembly. Sci Rep. 2018 Mar 7;8(1):4110. doi: 10.1038/s41598-018-22527-y. PMID: 29515200; [2] Santin YG, Cascales E. Domestication of a housekeeping transglycosylase for assembly of a Type VI secretion system. EMBO Rep. 2017 Jan;18(1):138-149. doi: 10.15252/embr.201643206. Epub 2016 Dec 5. PMID: 27920034
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) EC042_1244 (mltE)
Coordinates (Strand) 1322321..1322932 (+)
NCBI ID 481024453
RefSeq NC_017626
Uniprot ID EMTA_ECO55, EMTA_ECO57, EMTA_ECO5E, EMTA_ECO8A, EMTA_ECOLU, EMTA_SHIFL, A0A023YW18_ECOLR, A0A026V845_ECOLX, A0A028AA36_ECOLX, A0A028E6D5_ECOLX, A0A073GA07_ECOLX, A0A073HKR1_ECOLX, A0A073UKD5_ECOLX, A0A080FYX7_ECOLX, A0A080IZZ7_ECOLX, A0A0E0Y1N3_ECO1C, A0A0H3PS49_ECO5C, A0A0J3W0U9_ECOLX, A0A0K9T6W6_ECOLX, A0A1Q8MN73_SHIBO, A0A1S9K9R3_SHIDY, A0A1Z3V3B8_ECOLX, A0A236H453_SHISO, C8UNU9_ECO1A, D3H1Z2_ECO44, D3QQV8_ECOCB, D6I705_ECOLX, D6J9G1_ECOLX, E0IV67_ECOLW, I2RNF3_ECOLX, I2RVH3_ECOLX, I2T159_ECOLX, I2UDN8_ECOLX, I2WMU2_ECOLX, I4SCC5_ECOLX, K4VS62_ECOLX, K4WD52_ECOLX, L3CC28_ECOLX, L3P967_ECOLX, L3QAG0_ECOLX, L4JC60_ECOLX, L4VXH3_ECOLX, S1DCH0_ECOLX, S1HNV8_ECOLX, T9T781_ECOLX, V6G2Z6_ECOLX
KEGG ID ecs:ECs1687, ecf:ECH74115_1680, ece:Z1956, eok:G2583_1456, sfx:S1270, esl:O3K_14695, eum:ECUMN_1484, elo:EC042_1244, sfl:SF1186, ecr:ECIAI1_1211, eoi:ECO111_1522, elw:ECW_m1279, eck:EC55989_1289
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
SLT PF01464.22 6.9e-29 43..168

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-203 VKLRWFAFLIVLLAGCSSKHDYTNPPWNAKVPVQRAMQWMPISQKAGAAWGVDPQLITAIIAIESGGNPNAVSKSNAIGLMQLKASTSGRDVYRRMGWSGEPTTSELKNPERNISMGAAYLNILETGPLAGIEDPKVLQYALVVSYANGAGALLRTFSSDRKKAISKINDLDADEFLDHVARNHPAPQAPRYIYKLEQALDAM



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
LIPO(Sec/SPII) 0.9993 pos: 15-16. LAG-CS. VKLRWFAFLIVLLAG



  Protein sequence: 204 a.a.    

>ACP00034 NC_017626:1322321-1322932 [Escherichia coli 042]
VKLRWFAFLIVLLAGCSSKHDYTNPPWNAKVPVQRAMQWMPISQKAGAAWGVDPQLITAIIAIESGGNPNAVSKSNAIGL
MQLKASTSGRDVYRRMGWSGEPTTSELKNPERNISMGAAYLNILETGPLAGIEDPKVLQYALVVSYANGAGALLRTFSSD
RKKAISKINDLDADEFLDHVARNHPAPQAPRYIYKLEQALDAM*

  Nucleotide sequence: 612 bp    

>ACP00034 NC_017626:1322321-1322932 [Escherichia coli 042]
GTGAAATTAAGATGGTTTGCCTTTTTGATTGTGTTATTAGCGGGTTGTTCATCAAAGCATGACTACACGAACCCGCCGTG
GAACGCGAAAGTTCCGGTGCAACGTGCGATGCAGTGGATGCCAATAAGCCAGAAAGCCGGTGCAGCCTGGGGCGTCGATC
CACAATTGATCACGGCGATTATCGCTATCGAATCGGGTGGTAATCCGAACGCGGTGAGTAAATCGAATGCCATTGGTTTG
ATGCAGTTAAAAGCTTCAACCTCCGGACGTGATGTTTATCGCCGTATGGGCTGGAGTGGTGAGCCGACGACCAGCGAGCT
GAAAAATCCGGAGCGTAATATTTCAATGGGGGCGGCTTACCTGAATATTCTGGAAACCGGCCCGCTGGCAGGCATTGAAG
ATCCGAAGGTACTGCAATATGCGCTGGTGGTGTCATATGCTAACGGGGCAGGTGCGCTGCTACGGACTTTCTCGTCAGAT
CGGAAAAAGGCGATCAGCAAAATCAACGATCTGGATGCTGACGAGTTCCTCGATCACGTAGCGCGAAATCATCCTGCGCC
GCAGGCTCCGCGCTATATCTACAAACTTGAGCAGGCACTGGACGCGATGTAA