Detailed information of accessory protein


Summary

Accessory protein ID ACP00032 experimental
Type structure affiliated protein
Related T6SS (Type) T6SS00931 (Type i4b)
Strain Escherichia coli 042
Replicon chromosome
Related structure protein TssA
Related effector -
Description TagA stops and stabilizes the extended sheath
Reference [1] Santin YG, Doan T, Lebrun R, et al. In vivo TssA proximity labelling during type VI secretion biogenesis reveals TagA as a protein that stops and holds the sheath. Nat Microbiol. 2018 Nov;3(11):1304-1313. doi: 10.1038/s41564-018-0234-3. Epub 2018 Oct 1. PMID: 30275513; [2] Szwedziak P, Pilhofer M. Bidirectional contraction of a type six secretion system. Nat Commun. 2019 Apr 5;10(1):1565. doi: 10.1038/s41467-019-09603-1. PMID: 30952865
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) EC042_RS24300 (tagA)
Coordinates (Strand) 4884070..4885437 (+)
NCBI ID 446122356
RefSeq NC_017626
Uniprot ID B7LFT0_ECO55, D3GUY1_ECO44
KEGG ID elo:EC042_4550, eck:EC55989_3315
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
VasL PF12486.10 8.8e-42 306..449
ImpA_N PF06812.14 4.6e-19 8..109

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-455 MTSEVKLKTGGDPRSLPDYAALRDEISKLTHPARPDVDWRYVETLCLRLYEHNGVELQTASWYTIARMHTTGLSGLNEGLALIVALTRHHWSVMWPLNTHARLEIITGLFNHLQKTLRAMPPDDRDNLPLLYQTETFLKALSDTLARHELKQSSKVALPEAMVKGYITRLENQPVQGEVSSPVTLPAQALRSDAPDVQEHQTLPHSRLVYVVSETKAESGKENTHSLQKSPPTFLKPFVTGVCAALLAVSVAIPGWQFLTQPSPAEQQLRALLTPPPDVLSAGQMTQLSRTPSLLNHASEWITLSGQQITRLAELPPAYNLQRSAQLLQQLRVLFPDNPRVQEMVDNWQKSVRSRALPEEAMAGWNEGMTRLQQLAERLNRLDEQRGKYMTVSELKTEVFGIMQAFNRHIPAEEQLRRYDEVRNQNSSEQQQKKVENGLVELVSRYWVLTQGDMK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9933 - -



  Protein sequence: 456 a.a.    

>ACP00032 NC_017626:4884070-4885437 [Escherichia coli 042]
MTSEVKLKTGGDPRSLPDYAALRDEISKLTHPARPDVDWRYVETLCLRLYEHNGVELQTASWYTIARMHTTGLSGLNEGL
ALIVALTRHHWSVMWPLNTHARLEIITGLFNHLQKTLRAMPPDDRDNLPLLYQTETFLKALSDTLARHELKQSSKVALPE
AMVKGYITRLENQPVQGEVSSPVTLPAQALRSDAPDVQEHQTLPHSRLVYVVSETKAESGKENTHSLQKSPPTFLKPFVT
GVCAALLAVSVAIPGWQFLTQPSPAEQQLRALLTPPPDVLSAGQMTQLSRTPSLLNHASEWITLSGQQITRLAELPPAYN
LQRSAQLLQQLRVLFPDNPRVQEMVDNWQKSVRSRALPEEAMAGWNEGMTRLQQLAERLNRLDEQRGKYMTVSELKTEVF
GIMQAFNRHIPAEEQLRRYDEVRNQNSSEQQQKKVENGLVELVSRYWVLTQGDMK*

  Nucleotide sequence: 1368 bp    

>ACP00032 NC_017626:4884070-4885437 [Escherichia coli 042]
ATGACTTCTGAAGTGAAACTGAAAACCGGTGGTGACCCCCGGTCATTACCGGATTATGCTGCCCTGCGCGATGAAATCAG
CAAACTGACTCACCCGGCACGCCCGGATGTGGACTGGCGTTACGTGGAAACACTCTGCCTGCGTCTGTATGAACACAATG
GCGTGGAATTACAGACGGCATCCTGGTACACCATCGCCCGGATGCATACAACAGGGTTAAGTGGTCTGAATGAAGGGCTG
GCTCTGATTGTGGCGCTGACCCGGCATCACTGGTCAGTGATGTGGCCGCTGAATACCCACGCCCGGCTGGAAATTATTAC
CGGTCTGTTCAACCATCTGCAAAAAACGCTTCGGGCCATGCCTCCGGACGACCGTGACAACCTGCCCCTGCTGTATCAGA
CCGAAACATTCCTGAAGGCACTGAGTGACACACTGGCCCGGCACGAACTTAAACAGAGCAGTAAAGTGGCTTTACCGGAA
GCCATGGTGAAGGGATATATCACCCGCCTGGAGAACCAGCCTGTGCAGGGTGAAGTATCGTCTCCGGTAACCCTTCCGGC
GCAGGCACTCCGGTCTGATGCTCCGGACGTACAGGAACATCAGACCCTGCCGCACTCCCGTCTGGTGTATGTTGTTTCTG
AAACAAAAGCAGAGAGCGGAAAAGAAAACACACATTCCCTTCAGAAATCCCCGCCCACGTTTCTGAAACCGTTTGTAACT
GGTGTCTGTGCGGCATTGCTGGCGGTCAGCGTGGCCATTCCGGGATGGCAGTTTCTGACACAGCCATCACCGGCGGAGCA
GCAACTCAGGGCGTTGCTGACACCACCACCGGATGTGCTTTCAGCAGGCCAGATGACACAGCTCAGCAGAACACCTTCAC
TGCTAAATCATGCGTCAGAGTGGATAACCCTTTCCGGTCAGCAGATAACACGACTGGCAGAACTACCCCCGGCATACAAC
CTGCAACGCAGTGCGCAGCTGCTGCAGCAACTGAGGGTACTTTTTCCCGACAATCCCCGTGTTCAGGAAATGGTGGATAA
CTGGCAGAAGAGTGTAAGGAGTCGTGCGCTCCCGGAAGAGGCGATGGCGGGCTGGAACGAAGGCATGACCCGCTTACAGC
AGCTGGCTGAGCGCCTGAACCGTCTGGATGAGCAGCGGGGAAAATACATGACGGTCAGTGAACTGAAAACGGAGGTGTTT
GGCATCATGCAGGCTTTTAACCGGCATATCCCGGCAGAAGAGCAGTTACGTCGCTATGATGAAGTTCGTAACCAGAATAG
CAGTGAACAGCAGCAAAAAAAGGTGGAAAATGGTCTTGTCGAGCTGGTGAGTCGTTACTGGGTTTTGACGCAAGGGGACA
TGAAGTGA