Detailed information of component protein


Summary

Component ID T6CP005146
Component protein type TssA
T6SS ID (Type) T6SS00464 experimental (Type i4b)
Strain Escherichia coli 042
Replicon chromosome
Sequence Protein sequence (359 a.a.); Nucleotide sequence (1077 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) EC042_RS24405
Coordinate (Strand) 4901485..4902561 (+)
NCBI ID WP_001033155.1
RefSeq NC_017626
Uniprot ID A0A0E0XW54_ECO1C, A0A222QR78_ECOLX, A0A2H3M0V0_ECOLX, B7LFQ6_ECO55, D3GUZ8_ECO44
KEGG ID esl:O3K_04405, elo:EC042_4572, eck:EC55989_3289
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
ImpA_N PF06812.14 1.6e-30 12..131

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-358 MNKIETDTLLLPVIGESPAGDDIEYDPVYSEIREARQNDPDYMSQGEWAVSEPRRADWRKVRKLCEVTLRNKSKDLQISCWYVESLTHLYALEGMHCGLEYLAKFISQYWTTCWPSQEEGQEIRYSKLVRLDIDLSEYLKAYPLLEDKEITLSEWYKVLSFEHGASLSEAGKERLIESEGDHSVESFKRAVGKYNPRKVSEQLLQLYDLPDKIDEIESSYFFHTHEDIHHIFAKTRHIISEITELLSRFLPQETLDHSSVSQFLGKPDSRDTRTALPEEKKEFYSALTPSTDKEMSREKAIEQLEKIAIFFRQSEPTSPVPYLLERAIRWSTMTMSEWLEELLKDNDSMEQINRVLKG



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9745 - -



  Protein sequence: 359 a.a.    

>T6CP005146 NC_017626:4901485-4902561 [Escherichia coli 042] [TssA]
MNKIETDTLLLPVIGESPAGDDIEYDPVYSEIREARQNDPDYMSQGEWAVSEPRRADWRKVRKLCEVTLRNKSKDLQISC
WYVESLTHLYALEGMHCGLEYLAKFISQYWTTCWPSQEEGQEIRYSKLVRLDIDLSEYLKAYPLLEDKEITLSEWYKVLS
FEHGASLSEAGKERLIESEGDHSVESFKRAVGKYNPRKVSEQLLQLYDLPDKIDEIESSYFFHTHEDIHHIFAKTRHIIS
EITELLSRFLPQETLDHSSVSQFLGKPDSRDTRTALPEEKKEFYSALTPSTDKEMSREKAIEQLEKIAIFFRQSEPTSPV
PYLLERAIRWSTMTMSEWLEELLKDNDSMEQINRVLKG*

  Nucleotide sequence: 1077 bp    

>T6CP005146 NC_017626:4901485-4902561 [Escherichia coli 042] [TssA]
ATGAACAAAATAGAAACGGATACATTACTGCTTCCTGTTATAGGAGAATCGCCGGCAGGTGATGATATTGAGTATGATCC
GGTGTATAGCGAAATACGGGAGGCAAGACAAAATGATCCGGACTATATGTCTCAGGGGGAATGGGCTGTCAGTGAACCCC
GCAGAGCTGACTGGAGAAAAGTAAGAAAATTATGTGAGGTTACTTTACGTAATAAGAGTAAGGACCTACAAATTAGTTGC
TGGTATGTGGAGTCCTTGACGCATTTATATGCTCTGGAAGGGATGCATTGCGGATTGGAATATCTTGCAAAGTTTATTTC
TCAGTACTGGACTACATGCTGGCCATCGCAGGAAGAAGGTCAGGAAATTCGTTACAGTAAATTGGTTCGTCTTGATATAG
ATTTATCAGAGTATCTGAAAGCATATCCTCTTCTTGAGGATAAGGAAATCACACTTTCTGAATGGTATAAGGTGTTATCG
TTTGAACATGGAGCAAGTTTGTCAGAAGCTGGAAAAGAAAGATTAATAGAGAGCGAAGGTGATCACTCTGTTGAGTCCTT
CAAAAGAGCTGTAGGAAAATATAATCCCCGCAAGGTTAGTGAGCAACTTCTCCAGCTTTATGATCTACCTGACAAAATTG
ATGAGATTGAATCTTCTTACTTCTTTCATACGCATGAAGATATACATCATATTTTCGCAAAAACCAGACATATCATCAGT
GAGATAACCGAGTTACTGAGTCGTTTTTTGCCGCAAGAAACACTGGATCACAGTTCAGTTTCTCAATTTCTAGGCAAACC
CGATAGCAGAGACACAAGGACAGCACTTCCTGAGGAGAAAAAGGAATTTTATTCTGCATTAACACCCTCAACAGATAAAG
AGATGTCAAGGGAGAAAGCTATAGAGCAACTGGAGAAAATAGCTATTTTTTTCAGGCAATCTGAACCAACCAGTCCTGTT
CCTTATCTTCTGGAGAGGGCCATACGTTGGTCAACAATGACTATGTCAGAATGGCTTGAGGAACTACTTAAAGATAATGA
CTCTATGGAACAAATAAACCGTGTCTTAAAAGGATGA