Detailed information of accessory protein


Summary

Accessory protein ID ACP00022 experimental
Type chaperone
Related T6SS (Type) T6SS00115 (Type i4b)
Strain Burkholderia thailandensis E264
Replicon chromosome
Related structure protein -
Related effector BTH_II1883 (TseM)
Description MnoT is an outer membrane active Mn2+ transporter and important in oxidative stress resistance and essential for the T6SS-4-dependent Mn2+ uptake that confers a contact-independent competitive advantage
Reference [1] Si M, Zhao C, Burkinshaw B, et al. Manganese scavenging and oxidative stress response mediated by type VI secretion system in Burkholderia thailandensis. Proc Natl Acad Sci U S A. 2017 Mar 14;114(11):E2233-E2242. doi: 10.1073/pnas.1614902114. Epub 2017 Feb 27. PMID: 28242693
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) BTH_RS20365 (monT)
Coordinates (Strand) 1796067..1798403 (+)
NCBI ID 497575584
RefSeq NC_007651
Uniprot ID Q2SY62_BURTA
KEGG ID bte:BTH_I1598
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
TonB_dep_Rec PF00593.26 2.7e-54 323..776
Plug PF07715.17 2.6e-14 69..179

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-778 MSHELAAHVARTRLAAACVAAFAWPAAHAVTTGAAVPADSTSAAAAETTASGKTLDIVRVTAQRPAFASDTPGVVEALTREQIDSHVNVTTEDALKYAPNLMVRRRYIGDRNSVFAGRDFNELQSARGLVYADGILLSNLLGSSYSYPPRWSLIQPDDIARVDVLYGPFSALYPGNAIGSTVQITTRKPDRLEASVSTQFFTQRYRDGYGFADSFGGNHQTARVADRVGRFWYALSLDRLENDSQPMQYASPNGTFDPRLGASVPVTGAVSDIGPNGRPRTIVGAQTIERTEQLNETLRFGYAFTDHVDATVTLGHWENHYRQHGDTFLRDAAGNPVYGGNVSFGGRSYTVSPTAFAPQTGDQENWLYGLGLDARLASGWKLSATASAYEVSRDVLRSASGAPTGAWDGGPGTVFHGDGTGWRTVDLRAESPDVRGHRFSFGYHFDTYFLRNATYNTADWQNAVPTTLANRYRGNTRTQALYAQDAWRFAPGWLATLGLRYERWDAYGGQLGNANATLGYAGRGATALSPKLALEWQPTDAWRLRLSFATGTRFPTVAELFQGTISNNAIVNNNPNLQPEKAIDWDFTAERDVGFGVVRTSVFQSDLRNSIYSQTTVAGASTYTNISNVDRVRVRGVELAFSGQDVAIKGLDVDANVSATNAQTLADAANPNYVGARWPRIPRMRANLLASYRFGEHWMTSVGVRYSGRQYNALDNSDVNPNVYGGTSSFAVVDLKARYRFDRHWLASFGIDNVTDRRYYVFHPYPGRTFYGELKWSL



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
SP(Sec/SPI) 0.7863 pos: 29-30. AHA-VT. MSHELAAHVARTRLAAACVAAFAWPAAHA



  Protein sequence: 779 a.a.    

>ACP00022 NC_007651:1796067-1798403 [Burkholderia thailandensis E264]
MSHELAAHVARTRLAAACVAAFAWPAAHAVTTGAAVPADSTSAAAAETTASGKTLDIVRVTAQRPAFASDTPGVVEALTR
EQIDSHVNVTTEDALKYAPNLMVRRRYIGDRNSVFAGRDFNELQSARGLVYADGILLSNLLGSSYSYPPRWSLIQPDDIA
RVDVLYGPFSALYPGNAIGSTVQITTRKPDRLEASVSTQFFTQRYRDGYGFADSFGGNHQTARVADRVGRFWYALSLDRL
ENDSQPMQYASPNGTFDPRLGASVPVTGAVSDIGPNGRPRTIVGAQTIERTEQLNETLRFGYAFTDHVDATVTLGHWENH
YRQHGDTFLRDAAGNPVYGGNVSFGGRSYTVSPTAFAPQTGDQENWLYGLGLDARLASGWKLSATASAYEVSRDVLRSAS
GAPTGAWDGGPGTVFHGDGTGWRTVDLRAESPDVRGHRFSFGYHFDTYFLRNATYNTADWQNAVPTTLANRYRGNTRTQA
LYAQDAWRFAPGWLATLGLRYERWDAYGGQLGNANATLGYAGRGATALSPKLALEWQPTDAWRLRLSFATGTRFPTVAEL
FQGTISNNAIVNNNPNLQPEKAIDWDFTAERDVGFGVVRTSVFQSDLRNSIYSQTTVAGASTYTNISNVDRVRVRGVELA
FSGQDVAIKGLDVDANVSATNAQTLADAANPNYVGARWPRIPRMRANLLASYRFGEHWMTSVGVRYSGRQYNALDNSDVN
PNVYGGTSSFAVVDLKARYRFDRHWLASFGIDNVTDRRYYVFHPYPGRTFYGELKWSL*

  Nucleotide sequence: 2337 bp    

>ACP00022 NC_007651:1796067-1798403 [Burkholderia thailandensis E264]
ATGTCCCATGAACTTGCCGCGCACGTCGCGCGCACGCGGCTCGCGGCCGCCTGCGTCGCGGCGTTCGCCTGGCCCGCCGC
GCACGCCGTCACGACGGGCGCCGCCGTCCCTGCCGATTCAACGTCCGCCGCCGCTGCCGAGACGACCGCATCCGGGAAAA
CCCTGGATATCGTCAGGGTGACCGCGCAGCGCCCCGCATTCGCGTCCGACACGCCCGGCGTCGTCGAGGCGCTCACGCGC
GAGCAGATCGATTCGCACGTCAACGTGACGACCGAAGACGCGCTCAAGTACGCGCCGAACCTGATGGTGCGCCGGCGCTA
TATCGGCGATCGCAACTCCGTGTTCGCCGGCCGCGATTTCAACGAGTTGCAGAGCGCGCGCGGACTCGTTTACGCGGACG
GCATCCTCCTGTCGAATCTGCTCGGCTCCAGTTACTCGTATCCGCCGCGTTGGTCGCTGATCCAGCCCGACGACATCGCG
CGCGTCGACGTGCTGTACGGCCCGTTCTCCGCGCTCTACCCGGGCAATGCGATCGGCTCGACCGTGCAGATCACGACGCG
CAAGCCGGATCGGCTCGAGGCGTCGGTGTCGACGCAGTTCTTCACGCAGCGCTATCGCGACGGCTACGGCTTTGCCGACA
GCTTCGGCGGCAATCACCAGACCGCGCGCGTCGCCGACCGCGTCGGGCGCTTCTGGTATGCGCTGTCGCTCGACCGGCTC
GAGAACGACAGCCAGCCGATGCAATACGCGAGCCCGAATGGCACGTTCGATCCGCGGCTCGGCGCGAGCGTGCCGGTGAC
GGGCGCCGTTTCCGACATCGGCCCGAACGGCCGGCCTCGGACGATCGTCGGCGCGCAGACGATCGAGCGCACCGAGCAGC
TCAACGAGACGCTGCGCTTCGGCTATGCGTTCACCGACCACGTCGATGCGACGGTTACGCTCGGCCACTGGGAGAATCAC
TACCGGCAGCACGGCGACACGTTCCTGCGCGACGCGGCGGGCAACCCGGTATACGGCGGCAACGTGTCGTTCGGCGGGCG
CAGCTACACGGTGTCGCCGACCGCGTTCGCGCCGCAGACCGGCGACCAGGAGAACTGGCTGTACGGGCTCGGGCTCGACG
CGCGTCTCGCATCAGGCTGGAAGCTGTCGGCGACCGCGTCCGCGTACGAGGTGTCGCGCGACGTGCTGCGCAGCGCGTCC
GGCGCGCCGACCGGCGCGTGGGACGGCGGCCCGGGCACGGTATTCCATGGCGACGGCACCGGCTGGCGCACCGTCGATTT
GCGAGCGGAGTCGCCCGACGTGCGCGGGCACCGCTTCTCGTTCGGCTATCACTTCGACACCTATTTCCTGCGCAACGCGA
CCTACAACACGGCGGACTGGCAAAACGCCGTGCCGACGACGCTTGCGAACCGTTATCGCGGCAACACGCGCACGCAGGCG
CTGTACGCGCAAGACGCGTGGCGTTTCGCGCCCGGCTGGCTCGCGACGCTCGGCCTGCGCTACGAACGATGGGATGCATA
CGGCGGCCAGCTCGGCAACGCGAACGCGACGCTCGGCTACGCCGGCCGTGGCGCGACCGCGCTGTCGCCGAAGCTCGCGC
TCGAATGGCAGCCAACGGACGCATGGCGCCTGCGGCTGTCGTTCGCGACGGGCACGCGCTTTCCGACCGTGGCCGAACTG
TTCCAGGGCACGATCTCGAACAACGCGATCGTCAACAACAACCCGAACCTGCAACCGGAAAAGGCGATCGACTGGGACTT
CACGGCCGAGCGCGACGTCGGCTTCGGCGTCGTGCGCACGAGCGTGTTCCAGAGCGATCTGCGCAATTCGATCTACAGCC
AGACGACGGTCGCGGGCGCTTCGACGTACACGAACATCTCGAACGTCGACCGCGTGCGGGTGCGCGGCGTCGAACTCGCG
TTTTCAGGGCAGGACGTCGCGATCAAGGGGCTCGACGTTGACGCGAACGTGTCCGCGACGAATGCGCAGACGCTCGCCGA
TGCGGCGAATCCGAACTACGTCGGCGCGCGTTGGCCGCGGATTCCACGGATGCGCGCGAACTTGCTCGCGTCGTACCGCT
TCGGCGAGCACTGGATGACGAGCGTCGGCGTGCGCTATTCGGGGCGGCAGTACAACGCGCTCGACAACAGCGACGTGAAC
CCGAACGTGTACGGCGGCACCAGTTCGTTTGCGGTCGTCGACCTCAAGGCGCGCTACCGGTTCGATCGGCACTGGCTCGC
GTCGTTCGGCATCGACAACGTGACCGATCGCCGCTACTACGTGTTTCACCCTTATCCAGGCCGCACTTTTTATGGAGAGT
TGAAATGGTCGCTGTGA