Detailed information of effector


Summary

Effector ID EFF01464 experimental
Effector type Tie
Cognate immunity protein -
Related T6SS (Type) T6SS00113 experimental (Type i1)
Strain Burkholderia thailandensis E264
Replicon chromosome
Sequence Protein sequence (142 a.a.); Nucleotide sequence (426 bp)
Description Mn2+-binding effector TseM is required for T6SS-4-Cdependent Mn2+ acquisition under oxidative stress. TseM interacts with a Mn2+-Specific TonB-Dependent Outer Membrane Transporter.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) BTH_II1883 (TseM)
Coordinates (Strand) 2281342..2281767 (-)
NCBI ID 83718045
RefSeq NC_007650
Uniprot ID UPI0000667A01
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-141 MRRRQRASRAGVVARRATPGDAQANSGRAPARPFQSFVSNGAMLMNKQIVAGIVAGLVSMSSHAQLGQLFQSVKEQVTQAATSQVNQGVRSATDEAVQATSSRTRKAINSVRSPSSAAAATSTSPSAAEETNDATLSEARK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.6197 - -



  Protein sequence: 142 a.a.    .

>EFF01464 NC_007650:c2281767-2281342 [Burkholderia thailandensis E264]
MRRRQRASRAGVVARRATPGDAQANSGRAPARPFQSFVSNGAMLMNKQIVAGIVAGLVSMSSHAQLGQLFQSVKEQVTQA
ATSQVNQGVRSATDEAVQATSSRTRKAINSVRSPSSAAAATSTSPSAAEETNDATLSEARK*

  Nucleotide sequence: 426 bp    .

>EFF01464 NC_007650:c2281767-2281342 [Burkholderia thailandensis E264]
TTGCGTCGGCGTCAGCGCGCTTCGCGCGCGGGCGTCGTCGCGCGCCGCGCGACGCCTGGCGATGCACAGGCGAATTCCGG
GCGCGCGCCGGCGCGCCCGTTTCAATCTTTTGTGAGCAATGGAGCAATGCTGATGAACAAGCAAATCGTGGCAGGGATCG
TGGCGGGGCTCGTGTCGATGAGCAGCCATGCGCAACTGGGGCAGTTGTTCCAGTCGGTGAAGGAGCAGGTGACGCAGGCG
GCGACGTCGCAGGTGAACCAGGGCGTGCGCTCGGCGACCGACGAGGCGGTGCAGGCCACCTCGTCGCGCACGCGCAAGGC
GATCAACTCGGTGCGCTCGCCTTCGTCGGCCGCCGCGGCTACGTCGACTTCGCCTTCGGCGGCCGAGGAGACGAATGACG
CGACGCTGAGCGAGGCGCGCAAGTAA