Detailed information of accessory protein


Summary

Accessory protein ID ACP00021 experimental
Type chaperone
Related T6SS (Type) T6SS00113 (Type i1)
Strain Burkholderia thailandensis E264
Replicon chromosome
Related structure protein -
Related effector BTH_II1884 (TseZ)
Description The zinc transport activity of T6SS4 and TseZ was mediated by the interaction of TseZ and outer membrane transporter HmuR
Reference [1] Si M, Wang Y, Zhang B, et al. The Type VI Secretion System Engages a Redox-Regulated Dual-Functional Heme Transporter for Zinc Acquisition. Cell Rep. 2017 Jul 25;20(4):949-959. doi: 10.1016/j.celrep.2017.06.081. PMID: 28746878
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) BTH_II2139 (hmuR)
Coordinates (Strand) 2626542..2628827 (+)
NCBI ID 644827063
RefSeq NC_007650
Uniprot ID UPI00046CDCCF
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
TonB_dep_Rec PF00593.26 1.2e-59 302..759
Plug PF07715.17 7.9e-25 74..193

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-761 MARRPLRAALFGAFGLYAAAARAAGAASEPAAAAPPSAASAPQVRHAASAATRGNARALDPITVTATRTASAASRTAASVSVITDSDLEEQQADNIKDALRYEPGVTVRRTAYRPANAALGGGRDGDSSINIRGLEGNRVLLMEDGIRLPSAFSFGPLEAGRGDYADLDTLKRIEILRGPASSLYGSDGLTGAVNFITKDPSDLLSIHGKKTYFSLRPSYDSVDRSVGAAVAAAGGNDRVQGMLIASGRRGHEVDTRGGDNSASTKRTTANPQDVYTESLLGKLTITPTPRDTFKLTAETVRRRIDTNVLSAINPPTTLGLTANDKLERNRLSIDYDFRDDASRWFQTAHVQLYYQESKQDQDAFETRGGRLQSRSRSNHYSERAFGGSAFAESGFATGPLAHKLLYGVDGSIDRIKSLRDGAVASPGESFPNKAFPDTDYTLFGAFVQDQIGFGKLLVTPGLRFDAYRLSPSAGDPLFTGKTVSSSDHELSPRLAVLYEVTPALIPYAQYAHGFRTPTPDQVNNSFSNPIYGYTSIGNPNLKPETSDTLEAGLRGTLGTGYGPLRYGVAAFAGRYRNFIAQRMIGGSGRPNDPLVFQYVNFTNARIHGFEGRAEWVMPNGFTLKTAMAFTKGTTRDNGAASEPLDTVNPFSAVFGVRYEPSERWFAQADLLLQAGKRGRDVSSAACREKTCFTPPSSFVVDLRGGYHFNKHVSAYLGIHNLFDRKYWNWSDVRGIAADSNVLDAYTAPGRSVAVSMKVDF



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
SP(Sec/SPI) 0.5435 pos: 23-24. ARA-AG. MARRPLRAALFGAFGLYAAAARA



  Protein sequence: 762 a.a.    

>ACP00021 NC_007650:2626542-2628827 [Burkholderia thailandensis E264]
MARRPLRAALFGAFGLYAAAARAAGAASEPAAAAPPSAASAPQVRHAASAATRGNARALDPITVTATRTASAASRTAASV
SVITDSDLEEQQADNIKDALRYEPGVTVRRTAYRPANAALGGGRDGDSSINIRGLEGNRVLLMEDGIRLPSAFSFGPLEA
GRGDYADLDTLKRIEILRGPASSLYGSDGLTGAVNFITKDPSDLLSIHGKKTYFSLRPSYDSVDRSVGAAVAAAGGNDRV
QGMLIASGRRGHEVDTRGGDNSASTKRTTANPQDVYTESLLGKLTITPTPRDTFKLTAETVRRRIDTNVLSAINPPTTLG
LTANDKLERNRLSIDYDFRDDASRWFQTAHVQLYYQESKQDQDAFETRGGRLQSRSRSNHYSERAFGGSAFAESGFATGP
LAHKLLYGVDGSIDRIKSLRDGAVASPGESFPNKAFPDTDYTLFGAFVQDQIGFGKLLVTPGLRFDAYRLSPSAGDPLFT
GKTVSSSDHELSPRLAVLYEVTPALIPYAQYAHGFRTPTPDQVNNSFSNPIYGYTSIGNPNLKPETSDTLEAGLRGTLGT
GYGPLRYGVAAFAGRYRNFIAQRMIGGSGRPNDPLVFQYVNFTNARIHGFEGRAEWVMPNGFTLKTAMAFTKGTTRDNGA
ASEPLDTVNPFSAVFGVRYEPSERWFAQADLLLQAGKRGRDVSSAACREKTCFTPPSSFVVDLRGGYHFNKHVSAYLGIH
NLFDRKYWNWSDVRGIAADSNVLDAYTAPGRSVAVSMKVDF*

  Nucleotide sequence: 2286 bp    

>ACP00021 NC_007650:2626542-2628827 [Burkholderia thailandensis E264]
CTGGCGCGGCGGCCGCTTCGCGCCGCGCTGTTCGGGGCCTTCGGCCTCTACGCGGCGGCCGCGCGCGCCGCGGGCGCCGC
CTCCGAACCCGCGGCCGCCGCGCCGCCGTCCGCCGCGTCCGCACCGCAAGTGCGACACGCGGCGAGCGCGGCCACACGCG
GCAACGCGCGCGCCCTCGACCCGATCACCGTCACCGCGACGCGCACCGCGTCGGCCGCGAGCCGCACCGCGGCGAGCGTA
TCGGTAATCACCGATTCGGACCTCGAAGAACAGCAGGCCGACAACATCAAGGACGCGCTGCGCTACGAGCCGGGCGTCAC
CGTGCGGCGCACCGCGTACCGGCCGGCGAACGCCGCGCTCGGCGGCGGCCGCGACGGCGATTCGAGCATCAACATCCGCG
GCCTCGAAGGCAACCGCGTGCTGCTGATGGAAGACGGCATCCGGCTGCCGAGCGCGTTCTCGTTCGGTCCGCTCGAAGCC
GGCCGCGGCGATTACGCCGATCTCGACACGCTCAAGCGCATCGAGATCCTGCGCGGCCCGGCCTCGTCGCTGTACGGCAG
CGACGGCCTGACGGGCGCCGTCAACTTCATCACGAAAGATCCGTCCGATCTGCTGTCGATCCACGGGAAGAAGACCTATT
TCTCGTTGCGGCCGAGCTACGACTCGGTCGACCGCAGCGTCGGCGCGGCCGTGGCGGCGGCGGGCGGCAACGACCGCGTG
CAGGGGATGCTGATCGCATCCGGCCGCCGAGGCCACGAGGTCGACACGCGCGGCGGCGACAATTCCGCGAGCACGAAGCG
CACGACCGCGAATCCCCAGGATGTCTACACGGAATCGCTGCTCGGCAAGCTGACGATCACGCCGACGCCACGCGACACGT
TCAAGCTCACCGCCGAGACGGTGCGGCGCCGGATCGACACGAACGTACTGTCGGCGATCAATCCGCCGACGACGCTCGGC
CTCACCGCGAACGACAAGCTCGAGCGCAACCGCCTGAGCATCGACTACGATTTCCGCGACGACGCGTCACGCTGGTTCCA
GACCGCGCACGTGCAGCTCTACTACCAGGAATCGAAACAGGATCAGGACGCGTTCGAGACGCGCGGCGGCCGCCTGCAAT
CGCGCTCTCGCTCGAACCATTACAGCGAGCGCGCGTTCGGCGGCTCCGCGTTCGCCGAGAGCGGCTTCGCGACCGGGCCG
CTCGCGCACAAGCTGCTGTACGGCGTCGACGGCAGCATCGACCGCATCAAGAGCCTGCGTGACGGCGCCGTCGCGAGCCC
CGGCGAGTCGTTCCCGAACAAGGCGTTTCCGGACACCGACTACACGCTGTTCGGCGCGTTCGTGCAGGACCAGATCGGCT
TCGGCAAGCTGCTCGTCACGCCGGGCCTACGCTTCGACGCATATCGGCTGAGCCCGAGCGCGGGCGATCCGCTCTTCACC
GGCAAGACGGTCAGCTCGAGCGATCACGAGCTGTCGCCGCGCCTCGCGGTGCTGTACGAGGTGACGCCCGCGCTGATCCC
GTATGCGCAGTACGCGCACGGCTTTCGCACGCCAACGCCCGACCAGGTCAACAACAGCTTCTCGAATCCGATCTATGGCT
ATACATCGATCGGCAATCCGAACCTGAAGCCCGAGACGAGCGACACGCTCGAAGCGGGCCTGCGCGGCACGCTCGGCACG
GGGTACGGGCCGCTGCGCTACGGCGTCGCCGCGTTCGCCGGCCGCTATCGGAACTTCATCGCGCAGCGCATGATCGGCGG
CAGCGGCCGGCCGAACGATCCGCTCGTGTTCCAGTACGTGAACTTCACGAACGCGCGCATCCACGGCTTCGAAGGGCGCG
CCGAGTGGGTGATGCCCAACGGCTTCACGCTGAAGACCGCGATGGCGTTCACGAAGGGCACGACGCGGGACAACGGCGCG
GCAAGCGAGCCGCTCGACACGGTCAACCCGTTCTCCGCCGTGTTCGGCGTGCGCTACGAGCCGAGCGAGCGCTGGTTCGC
GCAGGCCGACCTGCTGTTGCAGGCGGGCAAGCGCGGCCGCGACGTGTCGTCGGCCGCGTGCCGGGAGAAGACGTGCTTCA
CGCCGCCGTCGTCGTTCGTCGTCGATCTGCGCGGCGGCTATCACTTCAACAAGCACGTGAGCGCCTACCTCGGCATTCAC
AACCTGTTCGACCGCAAATACTGGAACTGGTCGGACGTGCGCGGCATCGCCGCCGATTCGAACGTGCTCGACGCATACAC
CGCTCCGGGCCGCAGCGTCGCGGTCAGCATGAAGGTGGATTTCTGA