Detailed information of effector


Summary

Effector ID EFF01825 experimental
Effector type Tie
Cognate immunity protein -
Related T6SS (Type) T6SS00113 experimental (Type i1)
Strain Burkholderia thailandensis E264
Replicon chromosome
Sequence Protein sequence (120 a.a.); Nucleotide sequence (360 bp)
Description T6SS4 secretes the zinc-binding effector TseZ for acquisition of Zn2+ under oxidative stress conditions and Interacts with the TonB-Dependent Heme Receptor HmuR
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) BTH_II1884 (TseZ)
Coordinates (Strand) 2281790..2282149 (-)
NCBI ID 497579572
RefSeq NC_007650
Uniprot ID A0A135HB79_BURTH, Q2T421_BURTA
KEGG ID btha:DR62_4340, bte:BTH_II1884
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DUF6277 PF19793.1 1.9e-53 1..117

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-119 MIDPKEIFAACNNAHQYGQDASGSMAKPFMDSIPNLSTASSSNASNLIGNVQEVGSKMLEHMSSIKSAVDKQVMIHQDNQQRQKTYDFNVDMRDLRPTNAVGFPEEMPSIFFAPFRTGK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9613 - -



  Protein sequence: 120 a.a.    .

>EFF01825 NC_007650:c2282149-2281790 [Burkholderia thailandensis E264]
MIDPKEIFAACNNAHQYGQDASGSMAKPFMDSIPNLSTASSSNASNLIGNVQEVGSKMLEHMSSIKSAVDKQVMIHQDNQ
QRQKTYDFNVDMRDLRPTNAVGFPEEMPSIFFAPFRTGK*

  Nucleotide sequence: 360 bp    .

>EFF01825 NC_007650:c2282149-2281790 [Burkholderia thailandensis E264]
ATGATTGATCCGAAGGAAATCTTCGCCGCATGCAACAACGCGCACCAGTACGGGCAGGACGCGAGCGGCTCGATGGCCAA
GCCGTTCATGGATTCGATCCCGAATCTGTCGACGGCGTCGTCGAGCAACGCGAGCAACCTGATCGGCAACGTGCAGGAGG
TCGGCTCGAAGATGCTCGAGCACATGTCGTCGATCAAGTCGGCGGTCGACAAGCAAGTGATGATCCATCAGGACAACCAG
CAGCGTCAGAAGACCTACGACTTCAACGTCGACATGCGGGACCTGCGCCCGACCAACGCGGTCGGTTTCCCGGAGGAGAT
GCCGTCGATCTTCTTCGCGCCGTTCAGGACCGGCAAGTGA