Detailed information of accessory protein


Summary

Accessory protein ID ACP00016 experimental
Type chaperone
Related T6SS (Type) T6SS00258 (Type i3)
Strain Yersinia pseudotuberculosis YPIII
Replicon chromosome
Related structure protein -
Related effector YPK_0954 (Tce1)
Description GST pull-down assays showed proteins specifically retained by GST-Tce1 were detected and mass spectrometric analysis identified Tce1 partners: BtuB, , OmpF , TolB.The specific interactions of Tce1 with BtuB, OmpF, and TolB were further supported by bacterial two-hybrid and in vitro binding assays
Reference [1] Song L, Pan J, Yang Y, et al. Contact-independent killing mediated by a T6SS effector with intrinsic cell-entry properties. Nat Commun. 2021 Jan 18;12(1):423. doi: 10.1038/s41467-020-20726-8. PMID: 33462232
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) YPK_2956 (tonB)
Coordinates (Strand) 3254339..3255631 (-)
NCBI ID 488139530
RefSeq NC_010465
Uniprot ID TOLB_YERP3, TOLB_YERPA, TOLB_YERPB, TOLB_YERPE, TOLB_YERPG, TOLB_YERPN, TOLB_YERPP, TOLB_YERPS, TOLB_YERPY, A0A0E8XSG8_9GAMM
KEGG ID yps:YPTB1159, ypm:YP_1032, ypi:YpsIP31758_2868, ype:YPO1124, ypn:YPN_2874, ypy:YPK_2956, ypk:y3055, ypa:YPA_0602, ypo:BZ17_1378, ypp:YPDSF_2572, ypb:YPTS_1236, ypg:YpAngola_A1397
PDB ID 4PWZ, 4R40

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
TolB_N PF04052.15 2.4e-31 23..122
PD40 PF07676.14 1.7e-09 282..315
PD40 PF07676.14 4.5e-09 237..272
PD40 PF07676.14 4.3e-05 199..223

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-430 MKQAFRVALGFLVLWASVLHAEVRIEITQGVDSARPIGVVPFKWMGPGTPPEEIGAIVGADLRNSGKFNPIDAARMPQQPSTAAEVTPAAWTALGIDAVVVGQVQPSADGSYVVSYQLVDTSGSAGSILAQNQYKVTKQWLRYSAHTVSDEVFEKLTGIKGAFRTRIAYVVKTNGGKFPHELRVSDYDGYNQFVVHRSPEPLMSPAWSPDGSKIAYVTFESGKSALVIQTLANGAIRQVASFPRHNGAPAFSPDGTKLAFALSKSGSLNLYVMDLASGQISQVTDGRSNNTEPSWFPDSQNLAYTSDQGGRPQVYKVNINGGVPQRITWEGSQNQNADVSPDGKFLVLVSSNGGAQHIAKQDLETGAVQVLTDTLLDETPSIAPNGTMVIYSSTQGLGSVLQLVSTDGRFKARLPATDGQVKFPAWSPYL



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
SP(Sec/SPI) 0.9877 pos: 21-22. LHA-EV. MKQAFRVALGFLVLWASVLHA



  Protein sequence: 431 a.a.    

>ACP00016 NC_010465:c3255631-3254339 [Yersinia pseudotuberculosis YPIII]
MKQAFRVALGFLVLWASVLHAEVRIEITQGVDSARPIGVVPFKWMGPGTPPEEIGAIVGADLRNSGKFNPIDAARMPQQP
STAAEVTPAAWTALGIDAVVVGQVQPSADGSYVVSYQLVDTSGSAGSILAQNQYKVTKQWLRYSAHTVSDEVFEKLTGIK
GAFRTRIAYVVKTNGGKFPHELRVSDYDGYNQFVVHRSPEPLMSPAWSPDGSKIAYVTFESGKSALVIQTLANGAIRQVA
SFPRHNGAPAFSPDGTKLAFALSKSGSLNLYVMDLASGQISQVTDGRSNNTEPSWFPDSQNLAYTSDQGGRPQVYKVNIN
GGVPQRITWEGSQNQNADVSPDGKFLVLVSSNGGAQHIAKQDLETGAVQVLTDTLLDETPSIAPNGTMVIYSSTQGLGSV
LQLVSTDGRFKARLPATDGQVKFPAWSPYL*

  Nucleotide sequence: 1293 bp    

>ACP00016 NC_010465:c3255631-3254339 [Yersinia pseudotuberculosis YPIII]
ATGAAGCAGGCATTTCGAGTAGCGCTAGGCTTTTTAGTTTTATGGGCTTCGGTATTACATGCAGAAGTTCGGATTGAGAT
TACCCAAGGGGTAGACTCAGCACGTCCGATTGGGGTTGTTCCGTTCAAATGGATGGGGCCGGGCACACCACCTGAAGAAA
TTGGCGCCATCGTAGGTGCAGATTTACGTAACAGCGGCAAATTTAACCCAATTGATGCTGCTCGTATGCCACAACAGCCT
TCCACAGCCGCTGAAGTAACCCCTGCTGCTTGGACTGCTTTGGGGATCGATGCCGTTGTTGTTGGCCAAGTTCAACCAAG
TGCTGACGGTAGCTATGTGGTCTCTTACCAGCTAGTGGATACTTCTGGCTCTGCTGGCAGCATTTTGGCGCAAAATCAGT
ATAAAGTGACTAAACAATGGTTACGTTATTCAGCGCACACCGTCAGTGATGAAGTATTTGAAAAACTCACTGGGATTAAA
GGCGCTTTCCGTACTCGCATTGCTTATGTTGTGAAAACTAACGGTGGTAAATTCCCACATGAATTACGGGTTTCTGATTA
CGATGGCTACAACCAGTTTGTCGTCCACCGCTCTCCTGAACCTCTGATGTCACCCGCTTGGTCACCAGATGGTAGCAAAA
TTGCCTATGTGACTTTTGAAAGTGGCAAATCAGCATTGGTTATTCAGACGCTGGCAAATGGTGCGATTAGGCAAGTGGCC
TCATTCCCACGTCATAACGGTGCACCCGCGTTCTCACCTGATGGCACCAAGCTGGCCTTCGCGTTATCTAAAAGCGGTAG
CCTGAACTTGTATGTTATGGACTTGGCTTCAGGTCAAATCAGCCAAGTGACGGATGGTCGTAGCAATAATACTGAACCAA
GCTGGTTCCCGGATAGCCAAAATCTGGCTTATACCTCGGATCAGGGGGGGCGTCCACAAGTTTATAAAGTGAATATTAAT
GGCGGTGTGCCACAGCGAATCACGTGGGAAGGTTCTCAGAACCAGAACGCAGACGTGAGCCCTGATGGTAAGTTCCTGGT
ATTGGTTAGTTCCAATGGTGGGGCACAACACATCGCCAAACAGGATCTGGAAACGGGAGCCGTTCAAGTATTAACGGACA
CGTTACTGGATGAAACGCCTAGTATCGCGCCTAACGGCACCATGGTTATCTATAGCTCGACACAAGGGCTGGGTTCCGTG
TTACAGCTGGTCTCGACTGATGGGCGTTTCAAAGCGCGTCTTCCGGCAACTGATGGACAGGTCAAATTTCCTGCCTGGTC
GCCGTATCTGTGA