Detailed information of accessory protein


Summary

Accessory protein ID ACP00008 experimental
Type chaperone
Related T6SS (Type) T6SS00005 (Type i4a)
Strain Pseudomonas aeruginosa PAO1
Replicon chromosome
Related structure protein -
Related effector PA4922 (Azu)
Description OprC interacts with Azu, and is critical for H2-T6SS-dependent Cu2+ acquisition during bacterial competition
Reference [1] Han Y, Wang T, Chen G, et al. A Pseudomonas aeruginosa type VI secretion system regulated by CueR facilitates copper acquisition. PLoS Pathog. 2019 Dec 2;15(12):e1008198. doi: 10.1371/journal.ppat.1008198. eCollection 2019 Dec. PMID: 31790504
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PA3790 (oprC)
Coordinates (Strand) 4247703..4249874 (-)
NCBI ID 15598985
RefSeq NC_002516
Uniprot ID G3XD89_PSEAE, P72121_PSEAI
KEGG ID pae:PA3790
PDB ID 6FOK, 6FOM

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
TonB_dep_Rec PF00593.26 7.3e-50 236..721
Plug PF07715.17 3.4e-12 91..181

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-723 MEKRMSTQQRAAGNACPTAAFSFDPARLAQRRRWAGAFAALCGLALSPSALLAEEHSQHQDHAVELAPSVVTGVAQSSPLTIVTNPKEPRQPVPASDGADYLKTIPGFAVIRNGGSNGDPVLRGMFGSRLNILTNGGMMLGACPNRMDAPTSYISPETYDKLTVIKGPQTVLWGPGASAGTILFEREPERFGELGSRVNASLLAGSNGRFDKVLDAAAGNRLGYLRFTGNHAQSDDYEDGAGNTVPSRWKKWNGDVAVGWTPDEDTLIELTAGKGDGEARYAGRGMDGSQFKRESLGLRFVKSNVSDVLEKVEAQVYYNYADHIMDNFRLRTPDPSSMMPMPMASQVDRRTLGGRLAATWRWDDFKLVTGVDAMRNEHRARGSKYDMMTDYYTDADQFPWSKDAVFHNYGAFGELTWFAAERDRLIGGLRLDRASVKDYRQTLKSGHMGHAMANPTANDTRADTLPSGFVRYEHDLADSPTTLYAGLGHAERFPDYWELFSPKRGPNGSVNAFDKIKPEKTTQLDFGLQYNGDKLQAWASGYVGVVQDFILFSYREGMMGSSTQATNVDARIMGGELGASYQLTGNWKTDASLAYAWGKNSSDDRALPQIPPLEARFGLTYEEGDWSAGSLWRVVAPQNRIARDQGNVVGKDFDKSAGFGVFSLNGAYRVTRNVKLSAGVDNLFDKDYTEHLNKAGDAGFGFSANETVPEPGRTFWTKVDFSF



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
TAT(Tat/SPI) 0.6243 pos: 53-54. LLA-EE. MEKRMSTQQRAAGNACPTAAFSFDPARLAQRRRWAGAFAALCGLALSPSALLA



  Protein sequence: 724 a.a.    

>ACP00008 NC_002516:c4249874-4247703 [Pseudomonas aeruginosa PAO1]
MEKRMSTQQRAAGNACPTAAFSFDPARLAQRRRWAGAFAALCGLALSPSALLAEEHSQHQDHAVELAPSVVTGVAQSSPL
TIVTNPKEPRQPVPASDGADYLKTIPGFAVIRNGGSNGDPVLRGMFGSRLNILTNGGMMLGACPNRMDAPTSYISPETYD
KLTVIKGPQTVLWGPGASAGTILFEREPERFGELGSRVNASLLAGSNGRFDKVLDAAAGNRLGYLRFTGNHAQSDDYEDG
AGNTVPSRWKKWNGDVAVGWTPDEDTLIELTAGKGDGEARYAGRGMDGSQFKRESLGLRFVKSNVSDVLEKVEAQVYYNY
ADHIMDNFRLRTPDPSSMMPMPMASQVDRRTLGGRLAATWRWDDFKLVTGVDAMRNEHRARGSKYDMMTDYYTDADQFPW
SKDAVFHNYGAFGELTWFAAERDRLIGGLRLDRASVKDYRQTLKSGHMGHAMANPTANDTRADTLPSGFVRYEHDLADSP
TTLYAGLGHAERFPDYWELFSPKRGPNGSVNAFDKIKPEKTTQLDFGLQYNGDKLQAWASGYVGVVQDFILFSYREGMMG
SSTQATNVDARIMGGELGASYQLTGNWKTDASLAYAWGKNSSDDRALPQIPPLEARFGLTYEEGDWSAGSLWRVVAPQNR
IARDQGNVVGKDFDKSAGFGVFSLNGAYRVTRNVKLSAGVDNLFDKDYTEHLNKAGDAGFGFSANETVPEPGRTFWTKVD
FSF*

  Nucleotide sequence: 2172 bp    

>ACP00008 NC_002516:c4249874-4247703 [Pseudomonas aeruginosa PAO1]
ATGGAAAAACGTATGTCTACTCAACAACGAGCGGCCGGCAACGCCTGCCCGACCGCCGCTTTCAGCTTCGACCCTGCCCG
TCTCGCACAACGCCGCCGCTGGGCGGGAGCCTTCGCCGCACTGTGCGGCCTGGCCCTGTCTCCGTCGGCGCTCCTGGCCG
AGGAACACTCACAGCACCAGGATCACGCCGTGGAGCTGGCGCCGAGCGTGGTCACCGGAGTCGCCCAGAGTTCGCCGCTG
ACCATCGTCACCAATCCCAAGGAGCCGCGCCAACCGGTGCCGGCCAGCGATGGGGCCGACTACCTGAAGACCATTCCCGG
CTTCGCGGTGATCCGCAACGGCGGCAGCAACGGCGACCCGGTGCTGCGCGGGATGTTCGGTTCGCGCCTGAACATCCTCA
CCAACGGCGGCATGATGCTCGGTGCCTGTCCGAACCGGATGGACGCGCCGACCTCCTACATCTCGCCGGAAACCTACGAC
AAGCTCACCGTGATCAAGGGCCCGCAGACGGTGCTCTGGGGGCCGGGCGCGTCGGCCGGGACGATCCTCTTCGAGCGTGA
GCCGGAGCGCTTCGGCGAACTCGGCTCGCGGGTCAACGCCAGCCTGCTGGCCGGCTCCAATGGCCGCTTCGACAAGGTGC
TGGACGCCGCCGCCGGCAACCGGCTCGGCTACCTGCGCTTCACCGGCAACCACGCGCAGTCCGACGATTACGAGGACGGC
GCCGGGAATACCGTGCCGTCGCGCTGGAAGAAGTGGAACGGCGACGTCGCGGTCGGCTGGACCCCCGACGAGGACACCCT
GATCGAACTCACCGCCGGCAAGGGCGACGGCGAGGCACGCTACGCCGGGCGCGGCATGGACGGCTCGCAGTTCAAGCGCG
AGAGCCTGGGCCTGCGCTTCGTCAAATCGAACGTCAGCGATGTGCTGGAGAAGGTCGAGGCACAGGTCTACTACAACTAC
GCCGACCACATCATGGACAACTTCCGCCTGCGCACTCCCGACCCATCCAGCATGATGCCCATGCCGATGGCGTCCCAGGT
GGACCGACGCACCCTCGGCGGTCGCCTGGCGGCCACCTGGCGCTGGGACGACTTCAAGCTGGTCACCGGGGTCGACGCCA
TGCGCAACGAGCACCGCGCGCGCGGCTCCAAGTACGACATGATGACCGACTACTACACCGACGCCGACCAGTTCCCCTGG
AGCAAGGACGCGGTGTTCCACAACTACGGGGCCTTCGGCGAACTGACCTGGTTCGCCGCCGAGCGCGACCGGCTGATCGG
CGGGTTGCGCCTGGACCGCGCCTCGGTCAAGGACTACCGGCAGACCCTGAAGTCCGGGCACATGGGCCACGCCATGGCCA
ACCCGACGGCCAACGACACCCGCGCCGATACCCTGCCCAGCGGCTTCGTGCGCTACGAGCACGACCTCGCCGACTCGCCG
ACCACCCTCTACGCCGGCCTCGGCCATGCCGAGCGCTTCCCCGACTACTGGGAGCTGTTCTCGCCCAAGCGCGGGCCGAA
CGGGTCGGTCAACGCCTTCGACAAGATCAAGCCGGAAAAGACCACCCAGCTCGACTTCGGCCTCCAGTACAACGGCGACA
AGCTGCAGGCCTGGGCCTCCGGCTACGTCGGGGTGGTCCAGGACTTCATCCTGTTCAGCTATCGCGAGGGCATGATGGGT
TCCTCGACCCAGGCGACCAACGTCGACGCGCGGATCATGGGCGGCGAGCTGGGCGCTTCCTACCAGCTCACCGGCAACTG
GAAGACCGACGCCAGCCTGGCCTATGCCTGGGGCAAGAACAGCTCGGACGACCGCGCGCTGCCGCAGATCCCGCCGCTGG
AAGCGCGCTTCGGCCTGACCTACGAGGAAGGCGACTGGAGTGCCGGCAGCCTGTGGCGGGTGGTCGCGCCGCAGAATCGC
ATCGCCAGGGACCAGGGCAACGTGGTCGGCAAGGACTTCGACAAGAGCGCCGGCTTCGGCGTCTTCTCGCTCAACGGCGC
CTACCGGGTGACTCGCAACGTCAAGCTGAGCGCCGGTGTCGATAACCTGTTCGACAAGGATTACACCGAGCACCTGAACA
AGGCCGGCGACGCCGGCTTCGGTTTCTCCGCCAACGAAACGGTTCCAGAGCCGGGCCGGACCTTCTGGACCAAGGTCGAC
TTCAGCTTCTGA