Detailed information of effector


Summary

Effector ID EFF01823 experimental
Effector type Tie
Cognate immunity protein -
Related T6SS (Type) T6SS00004 experimental (Type i1)
Strain Pseudomonas aeruginosa PAO1
Replicon chromosome
Sequence Protein sequence (149 a.a.); Nucleotide sequence (447 bp)
Description PA4922 (Azu) and ClpV2 are involved in Cu2+ uptake
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PA4922 (Azu)
Coordinates (Strand) 5521664..5522110 (-)
NCBI ID 15600115
RefSeq NC_002516
Uniprot ID AZUR_PSEAE
KEGG ID pae:PA4922
PDB ID 1XB8, 2AZU, 3FQY, 1E67, 3IN0, 3OQR, 4HZ1, 3FQ2, 3IN2, 1JZG, 1AZU, 3N2J, 1JZH, 1XB3, 3FS9, 3JTB, 2XV2, 2XV3, 4JKN, 1R1C, 1JVO, 3UGE, 1JZE, 4HHW, 1ETJ, 2FT6, 3FPY, 3IBO, 3U25, 1E5Z, 2GHZ, 4KOC, 1JZI, 4KO9, 6MJS, 2I7S, 6MJR, 2HX9, 4AZU, 2OJ1, 3NP3, 4HIP, 1E5Y, 2FT8, 2GI0, 1BEX, 1GR7, 1ILS, 2FT7, 5YT7, 1CC3, 2TSA, 1I53, 2HXA, 6GYI, 1JVL, 6MJT, 5I26, 1NZR, 2XV0, 3FSZ, 4KO7, 4QLW, 1JZJ, 3AZU, 6IAV, 2HX7, 3NP4, 4MFH, 4BWW, 1AZN, 4K9J, 2TSB, 2IDF, 3FQ1, 4HHG, 4WKX, 1AG0, 1JZF, 2FNW, 2IWE, 5I28, 1ILU, 3FSV, 1AZR, 5SYD, 4KOB, 5AZU, 1VLX, 1XB6, 1E65, 1EZL, 3FSA, 4KO6, 2FTA, 2HX8, 3FT0, 3FSW, 4KO5, 4QKT, 3JT2, 2I7O

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Copper-bind PF00127.22 3e-32 21..148

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-148 MLRKLAAVSLLSLLSAPLLAAECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
SP(Sec/SPI) 0.9368 pos: 20-21. LLA-AE. MLRKLAAVSLLSLLSAPLLA



  Protein sequence: 149 a.a.    .

>EFF01823 NC_002516:c5522110-5521664 [Pseudomonas aeruginosa PAO1]
MLRKLAAVSLLSLLSAPLLAAECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVV
TDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK*

  Nucleotide sequence: 447 bp    .

>EFF01823 NC_002516:c5522110-5521664 [Pseudomonas aeruginosa PAO1]
ATGCTACGTAAACTCGCTGCGGTATCCCTGCTGTCCCTGCTCAGTGCGCCACTGCTGGCTGCCGAGTGCTCGGTGGACAT
CCAGGGTAACGACCAGATGCAGTTCAACACCAATGCCATCACCGTCGACAAGAGCTGCAAGCAGTTCACCGTCAACCTGT
CCCACCCCGGCAACCTGCCGAAGAACGTCATGGGCCACAACTGGGTACTGAGCACCGCCGCCGACATGCAGGGCGTGGTC
ACCGACGGCATGGCTTCCGGCCTGGACAAGGATTACCTGAAGCCCGACGACAGCCGTGTCATCGCCCACACCAAGCTGAT
CGGCTCGGGCGAGAAGGACTCGGTGACCTTCGACGTCTCCAAGCTGAAGGAAGGCGAGCAGTACATGTTCTTCTGCACCT
TCCCGGGCCACTCCGCGCTGATGAAGGGCACCCTGACCCTGAAGTGA