Detailed information of accessory protein


Summary

Accessory protein ID ACP00001 experimental
Type adaptor
Related T6SS (Type) T6SS00002 (Type i1)
Strain Vibrio cholerae O1 biovar El Tor str. N16961
Replicon chromosome
Related structure protein VgrG-1
Related effector VC1418 (TseL)
Description DUF4123 domain-containing protein.
Reference [1] Liang X, Moore R, Wilton M, et al. Identification of divergent type VI secretion effectors using a conserved chaperone domain. Proc Natl Acad Sci U S A. 2015 Jul 21;112(29):9106-11. doi: 10.1073/pnas.1505317112. Epub 2015 Jul 6. PMID: 26150500
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) VC1417
Coordinates (Strand) 1513748..1514608 (+)
NCBI ID 15641428
RefSeq NC_002505
Uniprot ID Q9KS44_VIBCH
KEGG ID vch:VC_1417
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DUF4123 PF13503.8 8.3e-16 28..140

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-286 MATHYCLVENGMEKMLLQWLSEQTSNVYWLADHLTFKQAVANNSGIVFDGTQVVFHGETFAPVMALSPWLVPVSDMVSDIDYECLQQGIFLSCSCPSTELLSHLQSLLIAALEGEEVLFRFYDRQVIVPMLERMDEIEKNQFLGKINQLVVFDSHEKNRLVSFTNTSDAQFTAKKTTWWVIKRHHLEAHENLPLVQANLESWLWRHFPKVMNEYLIQGRDIASMLAPSLSVPEQTLTYRVLSAAIVAVVGAEQLTQPSMIEFLRDYNNEEAQLALHALTRQFELRG



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9975 - -



  Protein sequence: 287 a.a.    

>ACP00001 NC_002505:1513748-1514608 [Vibrio cholerae O1 biovar El Tor str. N16961]
MATHYCLVENGMEKMLLQWLSEQTSNVYWLADHLTFKQAVANNSGIVFDGTQVVFHGETFAPVMALSPWLVPVSDMVSDI
DYECLQQGIFLSCSCPSTELLSHLQSLLIAALEGEEVLFRFYDRQVIVPMLERMDEIEKNQFLGKINQLVVFDSHEKNRL
VSFTNTSDAQFTAKKTTWWVIKRHHLEAHENLPLVQANLESWLWRHFPKVMNEYLIQGRDIASMLAPSLSVPEQTLTYRV
LSAAIVAVVGAEQLTQPSMIEFLRDYNNEEAQLALHALTRQFELRG*

  Nucleotide sequence: 861 bp    

>ACP00001 NC_002505:1513748-1514608 [Vibrio cholerae O1 biovar El Tor str. N16961]
ATGGCAACGCATTATTGCTTAGTGGAAAATGGAATGGAAAAGATGCTTTTACAATGGTTGAGTGAACAGACATCAAACGT
CTATTGGCTTGCTGATCATTTAACGTTTAAACAGGCGGTGGCGAATAACAGTGGAATTGTATTTGATGGTACACAAGTTG
TTTTCCACGGAGAGACCTTTGCCCCTGTGATGGCGTTATCGCCCTGGTTAGTCCCTGTCTCTGATATGGTATCGGATATC
GACTACGAGTGCTTACAACAAGGTATATTCCTAAGTTGCTCCTGTCCCTCCACAGAGTTATTAAGCCATCTCCAAAGCCT
TTTGATTGCAGCACTGGAAGGCGAAGAAGTACTGTTTCGTTTTTATGATAGGCAGGTCATTGTGCCTATGCTTGAACGAA
TGGATGAAATAGAAAAAAATCAGTTCTTAGGTAAGATAAATCAGTTAGTCGTGTTCGATAGCCATGAGAAAAATCGGTTA
GTCTCATTTACCAATACATCAGACGCTCAGTTTACGGCCAAAAAGACAACGTGGTGGGTGATCAAACGACACCATTTGGA
GGCTCATGAGAATTTGCCTCTTGTTCAAGCTAACCTCGAATCTTGGCTATGGCGGCATTTTCCAAAAGTGATGAACGAGT
ACTTAATTCAAGGGCGTGATATCGCTTCCATGCTCGCTCCATCTCTCTCTGTTCCTGAACAAACCTTAACATATCGTGTG
TTAAGTGCCGCTATCGTTGCTGTTGTCGGTGCCGAACAATTGACTCAGCCTAGCATGATTGAATTTCTACGAGACTATAA
CAACGAAGAAGCTCAGCTCGCTCTGCATGCTTTAACTCGTCAATTTGAACTAAGGGGATAA