Detailed information
Bioinformatically predicted
Overview
| Name | comC/comC1 | Type | Regulator |
| Locus tag | SP4011_RS11380 | Genome accession | NZ_AP026968 |
| Coordinates | 2323832..2323957 (-) | Length | 41 a.a. |
| NCBI ID | WP_218757899.1 | Uniprot ID | - |
| Organism | Streptococcus parapneumoniae strain SP4011 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2318832..2328957
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SP4011_RS11355 (SP4011_21960) | - | 2320952..2321494 (+) | 543 | WP_338619373.1 | TetR/AcrR family transcriptional regulator | - |
| SP4011_RS11370 (SP4011_21970) | comE | 2321737..2322489 (-) | 753 | WP_000866065.1 | competence system response regulator transcription factor ComE | Regulator |
| SP4011_RS11375 (SP4011_21980) | comD/comD1 | 2322486..2323811 (-) | 1326 | WP_218757900.1 | GHKL domain-containing protein | Regulator |
| SP4011_RS11380 (SP4011_21990) | comC/comC1 | 2323832..2323957 (-) | 126 | WP_218757899.1 | competence-stimulating peptide ComC | Regulator |
| SP4011_RS11390 (SP4011_22000) | rlmH | 2324240..2324719 (-) | 480 | WP_084367488.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| SP4011_RS11395 (SP4011_22010) | htrA | 2324903..2326084 (+) | 1182 | WP_338619378.1 | S1C family serine protease | Regulator |
| SP4011_RS11400 (SP4011_22020) | spo0J | 2326142..2326900 (+) | 759 | WP_338619379.1 | ParB/RepB/Spo0J family partition protein | Regulator |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4877.81 Da Isoelectric Point: 10.9061
>NTDB_id=99152 SP4011_RS11380 WP_218757899.1 2323832..2323957(-) (comC/comC1) [Streptococcus parapneumoniae strain SP4011]
MKNTVKLEQFVALKEKDLQKIKGGESRLSRLLRDFIFQIKQ
MKNTVKLEQFVALKEKDLQKIKGGESRLSRLLRDFIFQIKQ
Nucleotide
Download Length: 126 bp
>NTDB_id=99152 SP4011_RS11380 WP_218757899.1 2323832..2323957(-) (comC/comC1) [Streptococcus parapneumoniae strain SP4011]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCCTTGAAGGAAAAAGACTTGCAAAAGATTAAAGGTGGGGAAAGTAG
ACTGTCAAGATTACTCCGTGATTTTATTTTCCAAATAAAACAGTAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCCTTGAAGGAAAAAGACTTGCAAAAGATTAAAGGTGGGGAAAGTAG
ACTGTCAAGATTACTCCGTGATTTTATTTTCCAAATAAAACAGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC1 | Streptococcus pneumoniae G54 |
82.927 |
100 |
0.829 |
| comC/comC1 | Streptococcus pneumoniae D39 |
82.927 |
100 |
0.829 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
82.927 |
100 |
0.829 |
| comC/comC1 | Streptococcus pneumoniae R6 |
82.927 |
100 |
0.829 |
| comC | Streptococcus mitis SK321 |
75.61 |
100 |
0.756 |
| comC/comC2 | Streptococcus pneumoniae A66 |
83.784 |
90.244 |
0.756 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
83.784 |
90.244 |
0.756 |
| comC | Streptococcus mitis NCTC 12261 |
74.074 |
65.854 |
0.488 |