Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | WOC47_RS03495 | Genome accession | NZ_CP150761 |
| Coordinates | 626734..627204 (-) | Length | 156 a.a. |
| NCBI ID | WP_000934753.1 | Uniprot ID | A0A1S5YP95 |
| Organism | Staphylococcus aureus strain TUM22173 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 597034..656002 | 626734..627204 | within | 0 |
Gene organization within MGE regions
Location: 597034..656002
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WOC47_RS03275 (WOC47_03270) | scn | 597034..597384 (-) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| WOC47_RS03280 (WOC47_03275) | - | 598069..598518 (+) | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| WOC47_RS03285 (WOC47_03280) | - | 598613..598951 (-) | 339 | Protein_615 | SH3 domain-containing protein | - |
| WOC47_RS03290 (WOC47_03285) | sak | 599598..600089 (-) | 492 | WP_000919350.1 | staphylokinase | - |
| WOC47_RS03295 (WOC47_03290) | - | 600280..601035 (-) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| WOC47_RS03300 (WOC47_03295) | - | 601047..601301 (-) | 255 | WP_000611512.1 | phage holin | - |
| WOC47_RS03305 (WOC47_03300) | - | 601353..601460 (+) | 108 | WP_001791821.1 | hypothetical protein | - |
| WOC47_RS03310 (WOC47_03305) | pepG1 | 601513..601647 (-) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| WOC47_RS03315 (WOC47_03310) | - | 601839..602135 (-) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| WOC47_RS03320 (WOC47_03315) | - | 602193..602480 (-) | 288 | WP_001040261.1 | hypothetical protein | - |
| WOC47_RS03325 (WOC47_03320) | - | 602527..602679 (-) | 153 | WP_001153681.1 | hypothetical protein | - |
| WOC47_RS03330 (WOC47_03325) | - | 602669..606454 (-) | 3786 | WP_000582165.1 | phage tail spike protein | - |
| WOC47_RS03335 (WOC47_03330) | - | 606470..607954 (-) | 1485 | WP_000567394.1 | phage distal tail protein | - |
| WOC47_RS03340 (WOC47_03335) | - | 607951..612480 (-) | 4530 | WP_001551779.1 | phage tail tape measure protein | - |
| WOC47_RS03345 (WOC47_03340) | gpGT | 612537..612674 (-) | 138 | WP_001549167.1 | phage tail assembly chaperone GT | - |
| WOC47_RS03350 (WOC47_03345) | gpG | 612725..613075 (-) | 351 | WP_001096354.1 | phage tail assembly chaperone G | - |
| WOC47_RS03355 (WOC47_03350) | - | 613125..613364 (-) | 240 | WP_094969769.1 | Ig-like domain-containing protein | - |
| WOC47_RS03360 (WOC47_03355) | - | 613391..614035 (-) | 645 | WP_000260578.1 | major tail protein | - |
| WOC47_RS03365 (WOC47_03360) | - | 614039..614443 (-) | 405 | WP_000565500.1 | hypothetical protein | - |
| WOC47_RS03370 (WOC47_03365) | - | 614440..614844 (-) | 405 | WP_000114229.1 | HK97 gp10 family phage protein | - |
| WOC47_RS03375 (WOC47_03370) | - | 614841..615203 (-) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| WOC47_RS03380 (WOC47_03375) | - | 615187..615471 (-) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| WOC47_RS03385 (WOC47_03380) | - | 615461..615745 (-) | 285 | WP_000238236.1 | hypothetical protein | - |
| WOC47_RS03390 (WOC47_03385) | - | 615765..616910 (-) | 1146 | WP_000154559.1 | phage major capsid protein | - |
| WOC47_RS03395 (WOC47_03390) | - | 616934..617671 (-) | 738 | WP_000642728.1 | head maturation protease, ClpP-related | - |
| WOC47_RS03400 (WOC47_03395) | - | 617655..618842 (-) | 1188 | WP_000025274.1 | phage portal protein | - |
| WOC47_RS03405 (WOC47_03400) | - | 618858..620519 (-) | 1662 | WP_368409943.1 | terminase TerL endonuclease subunit | - |
| WOC47_RS03410 (WOC47_03405) | - | 620516..620860 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| WOC47_RS03415 (WOC47_03410) | - | 620990..621289 (-) | 300 | WP_000988336.1 | HNH endonuclease | - |
| WOC47_RS03420 (WOC47_03415) | - | 621521..621937 (-) | 417 | WP_000590122.1 | hypothetical protein | - |
| WOC47_RS03425 (WOC47_03420) | - | 621965..622165 (-) | 201 | WP_000265043.1 | DUF1514 family protein | - |
| WOC47_RS03430 (WOC47_03425) | rinB | 622165..622314 (-) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| WOC47_RS03435 (WOC47_03430) | - | 622311..622697 (-) | 387 | WP_000592207.1 | hypothetical protein | - |
| WOC47_RS03440 (WOC47_03435) | - | 622694..622900 (-) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| WOC47_RS03445 (WOC47_03440) | - | 622897..623142 (-) | 246 | WP_001282074.1 | hypothetical protein | - |
| WOC47_RS03450 (WOC47_03445) | - | 623179..623712 (-) | 534 | WP_000181819.1 | dUTP diphosphatase | - |
| WOC47_RS03455 (WOC47_03450) | - | 623705..623947 (-) | 243 | WP_000700108.1 | hypothetical protein | - |
| WOC47_RS03460 (WOC47_03455) | - | 623937..624173 (-) | 237 | WP_001065101.1 | DUF1024 family protein | - |
| WOC47_RS03465 (WOC47_03460) | - | 624166..624537 (-) | 372 | WP_001549172.1 | hypothetical protein | - |
| WOC47_RS03470 (WOC47_03465) | - | 624546..624788 (-) | 243 | WP_000131383.1 | phi PVL orf 51-like protein | - |
| WOC47_RS03475 (WOC47_03470) | - | 624792..625160 (-) | 369 | WP_000101288.1 | SA1788 family PVL leukocidin-associated protein | - |
| WOC47_RS03480 (WOC47_03475) | - | 625173..625577 (-) | 405 | WP_000401977.1 | RusA family crossover junction endodeoxyribonuclease | - |
| WOC47_RS03485 (WOC47_03480) | - | 625586..625804 (-) | 219 | WP_000338530.1 | hypothetical protein | - |
| WOC47_RS03490 (WOC47_03485) | - | 625811..626704 (-) | 894 | WP_000148333.1 | DnaD domain-containing protein | - |
| WOC47_RS03495 (WOC47_03490) | ssbA | 626734..627204 (-) | 471 | WP_000934753.1 | single-stranded DNA-binding protein | Machinery gene |
| WOC47_RS03500 (WOC47_03495) | - | 627205..627822 (-) | 618 | WP_071665632.1 | MBL fold metallo-hydrolase | - |
| WOC47_RS03505 (WOC47_03500) | - | 627903..628823 (-) | 921 | WP_000138475.1 | recombinase RecT | - |
| WOC47_RS03510 (WOC47_03505) | - | 628825..630768 (-) | 1944 | WP_000700561.1 | AAA family ATPase | - |
| WOC47_RS03515 (WOC47_03510) | - | 630777..631040 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| WOC47_RS03520 (WOC47_03515) | - | 631049..631309 (-) | 261 | WP_000291513.1 | DUF1108 family protein | - |
| WOC47_RS03525 (WOC47_03520) | - | 631349..631609 (-) | 261 | WP_001549178.1 | DUF2482 family protein | - |
| WOC47_RS03530 (WOC47_03525) | - | 631704..631865 (-) | 162 | WP_001285960.1 | DUF1270 domain-containing protein | - |
| WOC47_RS03535 (WOC47_03530) | - | 631862..632182 (-) | 321 | WP_001120199.1 | DUF771 domain-containing protein | - |
| WOC47_RS03540 (WOC47_03535) | - | 632241..632471 (+) | 231 | WP_000549548.1 | hypothetical protein | - |
| WOC47_RS03545 (WOC47_03540) | - | 632468..632644 (-) | 177 | WP_001001356.1 | hypothetical protein | - |
| WOC47_RS03550 (WOC47_03545) | - | 632660..633412 (-) | 753 | WP_001148642.1 | phage antirepressor KilAC domain-containing protein | - |
| WOC47_RS03555 (WOC47_03550) | - | 633463..633792 (+) | 330 | WP_000180411.1 | hypothetical protein | - |
| WOC47_RS03560 (WOC47_03555) | - | 633781..633996 (-) | 216 | WP_001025404.1 | MW1434 family type I TA system toxin | - |
| WOC47_RS03565 (WOC47_03560) | - | 634012..634275 (-) | 264 | WP_000854072.1 | helix-turn-helix transcriptional regulator | - |
| WOC47_RS03570 (WOC47_03565) | - | 634272..634445 (-) | 174 | WP_001801500.1 | hypothetical protein | - |
| WOC47_RS03575 (WOC47_03570) | - | 634408..635121 (+) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| WOC47_RS03580 (WOC47_03575) | - | 635137..636069 (+) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| WOC47_RS03585 (WOC47_03580) | - | 636075..636416 (+) | 342 | WP_000591749.1 | hypothetical protein | - |
| WOC47_RS03590 (WOC47_03585) | - | 636620..636802 (+) | 183 | WP_000705246.1 | hypothetical protein | - |
| WOC47_RS03595 (WOC47_03590) | - | 636880..637593 (+) | 714 | WP_001549185.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| WOC47_RS03600 (WOC47_03595) | - | 637784..638821 (+) | 1038 | WP_000857199.1 | site-specific integrase | - |
| WOC47_RS03605 (WOC47_03600) | sph | 638878..639702 (+) | 825 | Protein_679 | sphingomyelin phosphodiesterase | - |
| WOC47_RS03610 (WOC47_03605) | lukG | 639940..640956 (-) | 1017 | WP_000595324.1 | bi-component leukocidin LukGH subunit G | - |
| WOC47_RS03615 (WOC47_03610) | lukH | 640978..642033 (-) | 1056 | WP_000791407.1 | bi-component leukocidin LukGH subunit H | - |
| WOC47_RS03620 (WOC47_03615) | - | 642468..643691 (+) | 1224 | WP_000206639.1 | ArgE/DapE family deacylase | - |
| WOC47_RS03625 (WOC47_03620) | - | 644063..644908 (-) | 846 | WP_000812010.1 | class I SAM-dependent methyltransferase | - |
| WOC47_RS03630 (WOC47_03625) | - | 644970..645882 (-) | 913 | Protein_684 | iron-hydroxamate ABC transporter substrate-binding protein | - |
| WOC47_RS03635 (WOC47_03630) | - | 646043..647350 (+) | 1308 | WP_001045079.1 | TrkH family potassium uptake protein | - |
| WOC47_RS03640 (WOC47_03635) | - | 648203..648646 (-) | 444 | WP_000022887.1 | GNAT family N-acetyltransferase | - |
| WOC47_RS03645 (WOC47_03640) | - | 648752..649188 (-) | 437 | Protein_687 | hypothetical protein | - |
| WOC47_RS03650 (WOC47_03645) | - | 649506..650096 (-) | 591 | WP_001293058.1 | terminase small subunit | - |
| WOC47_RS03655 (WOC47_03650) | - | 650093..650305 (-) | 213 | WP_000128898.1 | LuxR C-terminal-related transcriptional regulator | - |
| WOC47_RS03660 (WOC47_03655) | - | 650366..650912 (+) | 547 | Protein_690 | site-specific integrase | - |
| WOC47_RS03665 (WOC47_03660) | groL | 651007..652623 (-) | 1617 | WP_000240645.1 | chaperonin GroEL | - |
| WOC47_RS03670 (WOC47_03665) | groES | 652699..652983 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
| WOC47_RS03675 (WOC47_03670) | mroQ | 653158..653901 (+) | 744 | WP_000197635.1 | CPBP family intramembrane glutamic endopeptidase MroQ | - |
| WOC47_RS03680 (WOC47_03675) | - | 653926..655179 (-) | 1254 | WP_000120307.1 | SdrH family protein | - |
| WOC47_RS03685 (WOC47_03680) | - | 655376..656002 (+) | 627 | WP_000522384.1 | nitroreductase family protein | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17668.55 Da Isoelectric Point: 5.2672
>NTDB_id=972051 WOC47_RS03495 WP_000934753.1 626734..627204(-) (ssbA) [Staphylococcus aureus strain TUM22173]
MLNRTILVGRLTRDPELRTTQNGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MLNRTILVGRLTRDPELRTTQNGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=972051 WOC47_RS03495 WP_000934753.1 626734..627204(-) (ssbA) [Staphylococcus aureus strain TUM22173]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAATGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAATGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
56.497 |
100 |
0.641 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50 |
100 |
0.545 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
33.333 |
100 |
0.378 |
| ssb | Neisseria meningitidis MC58 |
33.526 |
100 |
0.372 |
| ssb | Neisseria gonorrhoeae MS11 |
33.526 |
100 |
0.372 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
47.5 |
76.923 |
0.365 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
47.5 |
76.923 |
0.365 |