Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | UXR46_RS07715 | Genome accession | NZ_CP148079 |
| Coordinates | 1547211..1547681 (+) | Length | 156 a.a. |
| NCBI ID | WP_000934753.1 | Uniprot ID | A0A1S5YP95 |
| Organism | Staphylococcus aureus strain BSN155-2 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1535611..1577381 | 1547211..1547681 | within | 0 |
Gene organization within MGE regions
Location: 1535611..1577381
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| UXR46_RS07615 (UXR46_07615) | - | 1536821..1537535 (-) | 715 | Protein_1482 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| UXR46_RS07620 (UXR46_07620) | - | 1537613..1537795 (-) | 183 | WP_000705246.1 | hypothetical protein | - |
| UXR46_RS07625 (UXR46_07625) | - | 1537999..1538340 (-) | 342 | WP_000591749.1 | hypothetical protein | - |
| UXR46_RS07630 (UXR46_07630) | - | 1538346..1539278 (-) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| UXR46_RS07635 (UXR46_07635) | - | 1539294..1540007 (-) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| UXR46_RS07640 (UXR46_07640) | - | 1539970..1540143 (+) | 174 | WP_001801500.1 | hypothetical protein | - |
| UXR46_RS07645 (UXR46_07645) | - | 1540140..1540403 (+) | 264 | WP_000854072.1 | helix-turn-helix transcriptional regulator | - |
| UXR46_RS07650 (UXR46_07650) | - | 1540419..1540634 (+) | 216 | WP_001025404.1 | MW1434 family type I TA system toxin | - |
| UXR46_RS07655 (UXR46_07655) | - | 1540623..1540952 (-) | 330 | WP_000180411.1 | hypothetical protein | - |
| UXR46_RS07660 (UXR46_07660) | - | 1541003..1541755 (+) | 753 | WP_001148642.1 | phage antirepressor KilAC domain-containing protein | - |
| UXR46_RS07665 (UXR46_07665) | - | 1541771..1541947 (+) | 177 | WP_001001356.1 | hypothetical protein | - |
| UXR46_RS07670 (UXR46_07670) | - | 1541944..1542174 (-) | 231 | WP_000549548.1 | hypothetical protein | - |
| UXR46_RS07675 (UXR46_07675) | - | 1542233..1542553 (+) | 321 | WP_001120199.1 | DUF771 domain-containing protein | - |
| UXR46_RS07680 (UXR46_07680) | - | 1542550..1542711 (+) | 162 | WP_001285960.1 | DUF1270 domain-containing protein | - |
| UXR46_RS07685 (UXR46_07685) | - | 1542806..1543066 (+) | 261 | WP_001549178.1 | DUF2482 family protein | - |
| UXR46_RS07690 (UXR46_07690) | - | 1543106..1543366 (+) | 261 | WP_000291513.1 | DUF1108 family protein | - |
| UXR46_RS07695 (UXR46_07695) | - | 1543375..1543638 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| UXR46_RS07700 (UXR46_07700) | - | 1543647..1545590 (+) | 1944 | WP_000700561.1 | AAA family ATPase | - |
| UXR46_RS07705 (UXR46_07705) | - | 1545592..1546512 (+) | 921 | WP_000138475.1 | recombinase RecT | - |
| UXR46_RS07710 (UXR46_07710) | - | 1546593..1547210 (+) | 618 | WP_071665632.1 | MBL fold metallo-hydrolase | - |
| UXR46_RS07715 (UXR46_07715) | ssbA | 1547211..1547681 (+) | 471 | WP_000934753.1 | single-stranded DNA-binding protein | Machinery gene |
| UXR46_RS07720 (UXR46_07720) | - | 1547711..1548604 (+) | 894 | WP_000148333.1 | DnaD domain-containing protein | - |
| UXR46_RS07725 (UXR46_07725) | - | 1548611..1548829 (+) | 219 | WP_000338530.1 | hypothetical protein | - |
| UXR46_RS07730 (UXR46_07730) | - | 1548838..1549242 (+) | 405 | WP_000401977.1 | RusA family crossover junction endodeoxyribonuclease | - |
| UXR46_RS07735 (UXR46_07735) | - | 1549255..1549623 (+) | 369 | WP_000101288.1 | SA1788 family PVL leukocidin-associated protein | - |
| UXR46_RS07740 (UXR46_07740) | - | 1549627..1549869 (+) | 243 | WP_000131383.1 | phi PVL orf 51-like protein | - |
| UXR46_RS07745 (UXR46_07745) | - | 1549878..1550249 (+) | 372 | WP_001549172.1 | hypothetical protein | - |
| UXR46_RS07750 (UXR46_07750) | - | 1550242..1550478 (+) | 237 | WP_001065101.1 | DUF1024 family protein | - |
| UXR46_RS07755 (UXR46_07755) | - | 1550468..1550710 (+) | 243 | WP_000700108.1 | hypothetical protein | - |
| UXR46_RS07760 (UXR46_07760) | - | 1550703..1551236 (+) | 534 | WP_338908825.1 | dUTP pyrophosphatase | - |
| UXR46_RS07765 (UXR46_07765) | - | 1551273..1551518 (+) | 246 | WP_001282074.1 | hypothetical protein | - |
| UXR46_RS07770 (UXR46_07770) | - | 1551515..1551721 (+) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| UXR46_RS07775 (UXR46_07775) | - | 1551718..1552104 (+) | 387 | WP_000592207.1 | hypothetical protein | - |
| UXR46_RS07780 (UXR46_07780) | rinB | 1552101..1552250 (+) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| UXR46_RS07785 (UXR46_07785) | - | 1552250..1552450 (+) | 201 | WP_000265043.1 | DUF1514 family protein | - |
| UXR46_RS07790 (UXR46_07790) | - | 1552478..1552894 (+) | 417 | WP_000590122.1 | hypothetical protein | - |
| UXR46_RS07795 (UXR46_07795) | - | 1553126..1553425 (+) | 300 | WP_000988336.1 | HNH endonuclease | - |
| UXR46_RS07800 (UXR46_07800) | - | 1553555..1553899 (+) | 345 | WP_000402904.1 | hypothetical protein | - |
| UXR46_RS07805 (UXR46_07805) | - | 1553896..1555557 (+) | 1662 | WP_000625088.1 | terminase large subunit | - |
| UXR46_RS07810 (UXR46_07810) | - | 1555573..1556760 (+) | 1188 | WP_000025274.1 | phage portal protein | - |
| UXR46_RS07815 (UXR46_07815) | - | 1556744..1557481 (+) | 738 | WP_000642728.1 | head maturation protease, ClpP-related | - |
| UXR46_RS07820 (UXR46_07820) | - | 1557505..1558650 (+) | 1146 | WP_000154559.1 | phage major capsid protein | - |
| UXR46_RS07825 (UXR46_07825) | - | 1558670..1558954 (+) | 285 | WP_000238236.1 | hypothetical protein | - |
| UXR46_RS07830 (UXR46_07830) | - | 1558944..1559228 (+) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| UXR46_RS07835 (UXR46_07835) | - | 1559212..1559574 (+) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| UXR46_RS07840 (UXR46_07840) | - | 1559571..1559975 (+) | 405 | WP_000114229.1 | HK97 gp10 family phage protein | - |
| UXR46_RS07845 (UXR46_07845) | - | 1559972..1560376 (+) | 405 | WP_000565500.1 | hypothetical protein | - |
| UXR46_RS07850 (UXR46_07850) | - | 1560380..1561024 (+) | 645 | WP_000260578.1 | major tail protein | - |
| UXR46_RS07855 (UXR46_07855) | - | 1561051..1561290 (+) | 240 | WP_094969769.1 | Ig-like domain-containing protein | - |
| UXR46_RS07860 (UXR46_07860) | gpG | 1561340..1561690 (+) | 351 | WP_001096354.1 | phage tail assembly chaperone G | - |
| UXR46_RS07865 (UXR46_07865) | gpGT | 1561741..1561878 (+) | 138 | WP_001549167.1 | phage tail assembly chaperone GT | - |
| UXR46_RS07870 (UXR46_07870) | - | 1561935..1566464 (+) | 4530 | WP_001551779.1 | phage tail tape measure protein | - |
| UXR46_RS07875 (UXR46_07875) | - | 1566461..1567945 (+) | 1485 | WP_000567394.1 | phage tail domain-containing protein | - |
| UXR46_RS07880 (UXR46_07880) | - | 1567961..1571746 (+) | 3786 | WP_000582165.1 | phage tail spike protein | - |
| UXR46_RS07885 (UXR46_07885) | - | 1571736..1571888 (+) | 153 | WP_001153681.1 | hypothetical protein | - |
| UXR46_RS07890 (UXR46_07890) | - | 1571935..1572222 (+) | 288 | WP_001040261.1 | hypothetical protein | - |
| UXR46_RS07895 (UXR46_07895) | - | 1572280..1572576 (+) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| UXR46_RS07900 (UXR46_07900) | pepG1 | 1572768..1572902 (+) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| UXR46_RS07905 (UXR46_07905) | - | 1572955..1573062 (-) | 108 | WP_001791821.1 | hypothetical protein | - |
| UXR46_RS07910 (UXR46_07910) | - | 1573114..1573368 (+) | 255 | WP_000611512.1 | phage holin | - |
| UXR46_RS07915 (UXR46_07915) | - | 1573380..1574135 (+) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| UXR46_RS07920 (UXR46_07920) | sak | 1574326..1574817 (+) | 492 | WP_000919350.1 | staphylokinase | - |
| UXR46_RS07925 (UXR46_07925) | - | 1575464..1575802 (+) | 339 | Protein_1544 | SH3 domain-containing protein | - |
| UXR46_RS07930 (UXR46_07930) | - | 1575897..1576346 (-) | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| UXR46_RS07935 (UXR46_07935) | scn | 1577031..1577381 (+) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17668.55 Da Isoelectric Point: 5.2672
>NTDB_id=950330 UXR46_RS07715 WP_000934753.1 1547211..1547681(+) (ssbA) [Staphylococcus aureus strain BSN155-2]
MLNRTILVGRLTRDPELRTTQNGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MLNRTILVGRLTRDPELRTTQNGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=950330 UXR46_RS07715 WP_000934753.1 1547211..1547681(+) (ssbA) [Staphylococcus aureus strain BSN155-2]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAATGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAATGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
56.497 |
100 |
0.641 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50 |
100 |
0.545 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
33.333 |
100 |
0.378 |
| ssb | Neisseria meningitidis MC58 |
33.526 |
100 |
0.372 |
| ssb | Neisseria gonorrhoeae MS11 |
33.526 |
100 |
0.372 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
47.5 |
76.923 |
0.365 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
47.5 |
76.923 |
0.365 |