Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | V6U66_RS02610 | Genome accession | NZ_CP145864 |
| Coordinates | 494678..494863 (+) | Length | 61 a.a. |
| NCBI ID | WP_410534556.1 | Uniprot ID | - |
| Organism | Streptococcus salivarius strain KSS7 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 494926..511795 | 494678..494863 | flank | 63 |
Gene organization within MGE regions
Location: 494678..511795
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| V6U66_RS02610 (V6U66_02615) | prx | 494678..494863 (+) | 186 | WP_410534556.1 | Paratox | Regulator |
| V6U66_RS02615 (V6U66_02620) | - | 494926..495612 (-) | 687 | WP_410534646.1 | sensor histidine kinase | - |
| V6U66_RS02620 | - | 495630..495680 (+) | 51 | WP_410534648.1 | hypothetical protein | - |
| V6U66_RS02625 (V6U66_02625) | - | 495687..496295 (+) | 609 | WP_410534557.1 | hypothetical protein | - |
| V6U66_RS02630 (V6U66_02630) | - | 496375..496842 (+) | 468 | WP_045772495.1 | 8-oxo-dGTP diphosphatase | - |
| V6U66_RS02635 (V6U66_02635) | - | 497657..498274 (+) | 618 | WP_005376691.1 | SAP domain-containing protein | - |
| V6U66_RS02640 (V6U66_02640) | - | 498657..499865 (-) | 1209 | WP_045772496.1 | ATP-binding protein | - |
| V6U66_RS02645 (V6U66_02645) | - | 500208..500729 (+) | 522 | WP_045772497.1 | DUF2975 domain-containing protein | - |
| V6U66_RS02650 (V6U66_02650) | - | 500734..500958 (+) | 225 | WP_045772572.1 | helix-turn-helix domain-containing protein | - |
| V6U66_RS02655 (V6U66_02655) | - | 500948..501400 (+) | 453 | WP_045772498.1 | hypothetical protein | - |
| V6U66_RS02660 (V6U66_02660) | - | 501985..502242 (+) | 258 | WP_084869014.1 | hypothetical protein | - |
| V6U66_RS02665 (V6U66_02665) | - | 502367..503332 (-) | 966 | WP_197092265.1 | IS3 family transposase | - |
| V6U66_RS02670 (V6U66_02670) | - | 503329..504006 (-) | 678 | WP_002890056.1 | helix-turn-helix domain-containing protein | - |
| V6U66_RS02675 (V6U66_02675) | prx | 504150..504335 (+) | 186 | WP_045772500.1 | Paratox | Regulator |
| V6U66_RS02680 (V6U66_02680) | - | 504810..505250 (+) | 441 | WP_410534558.1 | helix-turn-helix domain-containing protein | - |
| V6U66_RS02685 (V6U66_02690) | - | 505784..506281 (-) | 498 | WP_045772502.1 | GNAT family N-acetyltransferase | - |
| V6U66_RS02690 (V6U66_02695) | - | 506312..506455 (-) | 144 | WP_158084825.1 | hypothetical protein | - |
| V6U66_RS02695 (V6U66_02700) | - | 506582..507664 (+) | 1083 | WP_410534559.1 | hypothetical protein | - |
| V6U66_RS02700 (V6U66_02705) | - | 507696..508094 (+) | 399 | WP_410534560.1 | hypothetical protein | - |
| V6U66_RS02705 (V6U66_02710) | - | 508106..508507 (+) | 402 | WP_410534561.1 | hypothetical protein | - |
| V6U66_RS02710 (V6U66_02715) | - | 508508..510451 (+) | 1944 | WP_410534562.1 | AAA family ATPase | - |
| V6U66_RS02715 (V6U66_02720) | - | 510525..510872 (+) | 348 | WP_073689792.1 | hypothetical protein | - |
| V6U66_RS02720 (V6U66_02725) | - | 510893..511225 (+) | 333 | WP_410534563.1 | hypothetical protein | - |
| V6U66_RS02725 (V6U66_02730) | tnpA | 511322..511795 (-) | 474 | WP_002891962.1 | IS200/IS605 family transposase | - |
Sequence
Protein
Download Length: 61 a.a. Molecular weight: 7125.13 Da Isoelectric Point: 4.2182
>NTDB_id=940567 V6U66_RS02610 WP_410534556.1 494678..494863(+) (prx) [Streptococcus salivarius strain KSS7]
MITYDEVMEAIERGFIKGDKISIVRRNGKIHDYVLPGEKVESEEIVEKEDLDVVLEELKEF
MITYDEVMEAIERGFIKGDKISIVRRNGKIHDYVLPGEKVESEEIVEKEDLDVVLEELKEF
Nucleotide
Download Length: 186 bp
>NTDB_id=940567 V6U66_RS02610 WP_410534556.1 494678..494863(+) (prx) [Streptococcus salivarius strain KSS7]
ATGATAACATATGATGAAGTAATGGAAGCGATAGAAAGAGGGTTTATCAAGGGCGATAAAATCAGCATTGTCCGACGAAA
TGGGAAGATTCATGATTATGTTTTACCAGGAGAGAAAGTAGAATCTGAAGAAATAGTGGAAAAAGAGGACTTAGATGTTG
TCCTTGAAGAGTTGAAGGAGTTCTAA
ATGATAACATATGATGAAGTAATGGAAGCGATAGAAAGAGGGTTTATCAAGGGCGATAAAATCAGCATTGTCCGACGAAA
TGGGAAGATTCATGATTATGTTTTACCAGGAGAGAAAGTAGAATCTGAAGAAATAGTGGAAAAAGAGGACTTAGATGTTG
TCCTTGAAGAGTTGAAGGAGTTCTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
55.172 |
95.082 |
0.525 |
| prx | Streptococcus pyogenes MGAS8232 |
55.172 |
95.082 |
0.525 |
| prx | Streptococcus pyogenes MGAS315 |
53.448 |
95.082 |
0.508 |
| prx | Streptococcus pyogenes MGAS315 |
51.724 |
95.082 |
0.492 |
| prx | Streptococcus pyogenes MGAS315 |
60.465 |
70.492 |
0.426 |
| prx | Streptococcus pyogenes MGAS315 |
58.14 |
70.492 |
0.41 |
| prx | Streptococcus pyogenes MGAS315 |
54.762 |
68.852 |
0.377 |