Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | VNN41_RS06300 | Genome accession | NZ_CP141713 |
| Coordinates | 1258020..1258514 (-) | Length | 164 a.a. |
| NCBI ID | WP_407350034.1 | Uniprot ID | - |
| Organism | Lactococcus garvieae strain VC11 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1258020..1303928 | 1258020..1258514 | within | 0 |
Gene organization within MGE regions
Location: 1258020..1303928
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| VNN41_RS06300 (VNN41_06290) | ssb | 1258020..1258514 (-) | 495 | WP_407350034.1 | single-stranded DNA-binding protein | Machinery gene |
| VNN41_RS06305 (VNN41_06295) | rpsF | 1258552..1258845 (-) | 294 | WP_003133129.1 | 30S ribosomal protein S6 | - |
| VNN41_RS06310 (VNN41_06300) | - | 1259032..1259244 (-) | 213 | WP_016171080.1 | hypothetical protein | - |
| VNN41_RS06315 (VNN41_06305) | - | 1259714..1261177 (+) | 1464 | WP_003133128.1 | amino acid permease | - |
| VNN41_RS06320 (VNN41_06310) | dnaX | 1261211..1262869 (-) | 1659 | WP_407350035.1 | DNA polymerase III subunit gamma/tau | - |
| VNN41_RS06325 (VNN41_06315) | - | 1262882..1263502 (-) | 621 | WP_407350036.1 | phosphotransferase | - |
| VNN41_RS06330 (VNN41_06320) | - | 1263515..1263994 (-) | 480 | WP_014025504.1 | GAF domain-containing protein | - |
| VNN41_RS06335 (VNN41_06325) | - | 1264466..1264678 (-) | 213 | WP_407350037.1 | hypothetical protein | - |
| VNN41_RS06345 (VNN41_06335) | - | 1265731..1266504 (-) | 774 | WP_407350038.1 | DUF3825 domain-containing protein | - |
| VNN41_RS06350 (VNN41_06340) | - | 1267078..1267779 (-) | 702 | WP_407350039.1 | CHAP domain-containing protein | - |
| VNN41_RS06355 (VNN41_06345) | - | 1267786..1268031 (-) | 246 | WP_407350040.1 | phage holin | - |
| VNN41_RS06360 (VNN41_06350) | - | 1268041..1268352 (-) | 312 | WP_339011347.1 | hypothetical protein | - |
| VNN41_RS06365 (VNN41_06355) | - | 1268353..1269471 (-) | 1119 | WP_407350041.1 | BppU family phage baseplate upper protein | - |
| VNN41_RS06370 (VNN41_06360) | - | 1269453..1271627 (-) | 2175 | WP_407350042.1 | phage tail spike protein | - |
| VNN41_RS06375 (VNN41_06365) | - | 1271624..1272385 (-) | 762 | WP_407350043.1 | distal tail protein Dit | - |
| VNN41_RS06380 (VNN41_06370) | - | 1272385..1275720 (-) | 3336 | WP_407350044.1 | hypothetical protein | - |
| VNN41_RS06385 (VNN41_06375) | - | 1275720..1276310 (-) | 591 | WP_407350045.1 | Gp15 family bacteriophage protein | - |
| VNN41_RS06390 (VNN41_06380) | - | 1276319..1276690 (-) | 372 | WP_407350046.1 | hypothetical protein | - |
| VNN41_RS06395 (VNN41_06385) | - | 1276793..1277218 (-) | 426 | WP_407350047.1 | phage tail tube protein | - |
| VNN41_RS06400 (VNN41_06390) | - | 1277221..1277619 (-) | 399 | WP_407350048.1 | minor capsid protein | - |
| VNN41_RS06405 (VNN41_06395) | - | 1277619..1277972 (-) | 354 | WP_407350049.1 | minor capsid protein | - |
| VNN41_RS06410 (VNN41_06400) | - | 1277972..1278310 (-) | 339 | WP_404883453.1 | hypothetical protein | - |
| VNN41_RS06415 (VNN41_06405) | - | 1278310..1278693 (-) | 384 | WP_407350050.1 | hypothetical protein | - |
| VNN41_RS06420 (VNN41_06410) | - | 1278738..1278959 (-) | 222 | WP_407350051.1 | hypothetical protein | - |
| VNN41_RS06425 (VNN41_06415) | - | 1279029..1279853 (-) | 825 | WP_407350052.1 | N4-gp56 family major capsid protein | - |
| VNN41_RS06430 (VNN41_06420) | - | 1279872..1280471 (-) | 600 | WP_407350053.1 | phage scaffolding protein | - |
| VNN41_RS06440 (VNN41_06430) | - | 1280642..1281850 (-) | 1209 | WP_407350054.1 | phage minor capsid protein | - |
| VNN41_RS06445 (VNN41_06435) | - | 1281853..1283334 (-) | 1482 | WP_407350055.1 | phage portal protein | - |
| VNN41_RS06450 (VNN41_06440) | - | 1283345..1284640 (-) | 1296 | WP_407350986.1 | PBSX family phage terminase large subunit | - |
| VNN41_RS06455 (VNN41_06445) | - | 1284637..1285170 (-) | 534 | WP_407350056.1 | terminase small subunit | - |
| VNN41_RS06460 (VNN41_06450) | - | 1285217..1285813 (-) | 597 | WP_407350057.1 | hypothetical protein | - |
| VNN41_RS06475 (VNN41_06465) | - | 1286713..1287108 (-) | 396 | WP_407350058.1 | DUF722 domain-containing protein | - |
| VNN41_RS06480 (VNN41_06470) | - | 1287238..1287450 (-) | 213 | WP_407350060.1 | hypothetical protein | - |
| VNN41_RS06485 (VNN41_06475) | - | 1287568..1287780 (-) | 213 | WP_407350061.1 | hypothetical protein | - |
| VNN41_RS06490 (VNN41_06480) | - | 1287773..1288255 (-) | 483 | WP_407350999.1 | hypothetical protein | - |
| VNN41_RS06495 (VNN41_06485) | - | 1288261..1288500 (-) | 240 | WP_407350062.1 | helix-turn-helix domain-containing protein | - |
| VNN41_RS06500 (VNN41_06490) | - | 1288493..1288819 (-) | 327 | WP_407350063.1 | hypothetical protein | - |
| VNN41_RS06505 (VNN41_06495) | - | 1288823..1288966 (-) | 144 | WP_407350064.1 | hypothetical protein | - |
| VNN41_RS06510 (VNN41_06500) | - | 1288992..1289789 (-) | 798 | WP_407350065.1 | DNA adenine methylase | - |
| VNN41_RS06515 (VNN41_06505) | - | 1289773..1290024 (-) | 252 | WP_407350066.1 | hypothetical protein | - |
| VNN41_RS06520 (VNN41_06510) | - | 1290021..1290323 (-) | 303 | WP_407350067.1 | hypothetical protein | - |
| VNN41_RS06525 (VNN41_06515) | - | 1290320..1290487 (-) | 168 | WP_407350987.1 | DUF6877 family protein | - |
| VNN41_RS06530 (VNN41_06520) | - | 1290762..1290935 (-) | 174 | WP_407350068.1 | hypothetical protein | - |
| VNN41_RS06535 (VNN41_06525) | - | 1291052..1291444 (-) | 393 | WP_407350069.1 | RusA family crossover junction endodeoxyribonuclease | - |
| VNN41_RS06540 (VNN41_06530) | - | 1291441..1291725 (-) | 285 | WP_407350070.1 | hypothetical protein | - |
| VNN41_RS06545 (VNN41_06535) | - | 1291709..1292497 (-) | 789 | WP_407350071.1 | helix-turn-helix domain-containing protein | - |
| VNN41_RS06550 (VNN41_06540) | - | 1292500..1292664 (-) | 165 | WP_339011889.1 | hypothetical protein | - |
| VNN41_RS06555 (VNN41_06545) | - | 1292677..1292895 (-) | 219 | WP_407350072.1 | helix-turn-helix domain-containing protein | - |
| VNN41_RS06560 (VNN41_06550) | - | 1293126..1294121 (-) | 996 | WP_407350073.1 | DUF1351 domain-containing protein | - |
| VNN41_RS06565 (VNN41_06555) | bet | 1294122..1294898 (-) | 777 | WP_407350074.1 | phage recombination protein Bet | - |
| VNN41_RS06570 (VNN41_06565) | - | 1295185..1295421 (-) | 237 | WP_407350075.1 | DNA-binding protein | - |
| VNN41_RS06575 (VNN41_06570) | - | 1295585..1295782 (+) | 198 | WP_407350076.1 | hypothetical protein | - |
| VNN41_RS06580 (VNN41_06575) | - | 1295821..1296090 (-) | 270 | WP_407350077.1 | hypothetical protein | - |
| VNN41_RS06585 (VNN41_06580) | - | 1296102..1296350 (-) | 249 | WP_407350078.1 | hypothetical protein | - |
| VNN41_RS06590 (VNN41_06585) | - | 1296579..1297379 (+) | 801 | WP_407350079.1 | S24 family peptidase | - |
| VNN41_RS06595 (VNN41_06590) | - | 1297393..1297593 (+) | 201 | WP_407350081.1 | hypothetical protein | - |
| VNN41_RS06600 (VNN41_06595) | - | 1297608..1297811 (+) | 204 | WP_407350082.1 | hypothetical protein | - |
| VNN41_RS06605 (VNN41_06600) | istB | 1297863..1298621 (-) | 759 | WP_341485250.1 | IS21-like element helper ATPase IstB | - |
| VNN41_RS06610 (VNN41_06605) | istA | 1298630..1299853 (-) | 1224 | WP_341485251.1 | IS21 family transposase | - |
| VNN41_RS06615 (VNN41_06610) | - | 1300085..1300645 (+) | 561 | WP_407350083.1 | hypothetical protein | - |
| VNN41_RS06620 (VNN41_06615) | - | 1300689..1301063 (+) | 375 | WP_407350084.1 | PH domain-containing protein | - |
| VNN41_RS06625 (VNN41_06620) | - | 1301187..1302305 (+) | 1119 | WP_407350085.1 | tyrosine-type recombinase/integrase | - |
| VNN41_RS06630 (VNN41_06625) | - | 1302534..1302827 (-) | 294 | WP_042218991.1 | hypothetical protein | - |
| VNN41_RS06635 (VNN41_06630) | - | 1302829..1303095 (-) | 267 | WP_003133123.1 | DUF2089 family protein | - |
| VNN41_RS06640 (VNN41_06635) | - | 1303235..1303504 (+) | 270 | WP_019299134.1 | chorismate mutase | - |
| VNN41_RS06645 (VNN41_06640) | - | 1303497..1303928 (-) | 432 | WP_165706169.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 164 a.a. Molecular weight: 18035.94 Da Isoelectric Point: 4.9533
>NTDB_id=918706 VNN41_RS06300 WP_407350034.1 1258020..1258514(-) (ssb) [Lactococcus garvieae strain VC11]
MINNVVLVGRVVRDPELRYTPQNTAVATFTIAVNRRFKNAQGEREADFINCVIWRQSAENLANWAKKGALIGVTGSIQMR
NYENKEGQRVYVTEVLADNFQMLESRAAREGGSGSYSAPQQQQSQNRPFAGSNSSAGNATPDFGRDADPFGGSPMEISDD
DLPF
MINNVVLVGRVVRDPELRYTPQNTAVATFTIAVNRRFKNAQGEREADFINCVIWRQSAENLANWAKKGALIGVTGSIQMR
NYENKEGQRVYVTEVLADNFQMLESRAAREGGSGSYSAPQQQQSQNRPFAGSNSSAGNATPDFGRDADPFGGSPMEISDD
DLPF
Nucleotide
Download Length: 495 bp
>NTDB_id=918706 VNN41_RS06300 WP_407350034.1 1258020..1258514(-) (ssb) [Lactococcus garvieae strain VC11]
ATGATTAATAATGTTGTTTTGGTCGGACGCGTTGTGCGTGACCCTGAACTGCGATATACACCGCAAAATACTGCGGTTGC
TACATTTACGATTGCTGTTAACCGTCGTTTTAAAAACGCGCAAGGCGAACGTGAAGCTGATTTCATTAACTGTGTCATCT
GGCGTCAATCTGCTGAAAACTTGGCAAATTGGGCTAAAAAAGGTGCCTTGATTGGTGTAACAGGTAGCATTCAAATGCGA
AATTATGAGAACAAAGAAGGTCAACGTGTTTACGTGACTGAAGTATTGGCTGATAACTTCCAAATGCTTGAGAGTCGTGC
CGCACGTGAAGGTGGCTCTGGTTCATATTCTGCACCACAGCAACAACAATCACAAAATCGTCCTTTTGCTGGCTCTAACA
GCTCAGCAGGAAATGCAACACCTGATTTTGGTCGTGATGCAGATCCATTTGGTGGCTCACCAATGGAAATCTCAGATGAT
GATCTTCCATTCTAA
ATGATTAATAATGTTGTTTTGGTCGGACGCGTTGTGCGTGACCCTGAACTGCGATATACACCGCAAAATACTGCGGTTGC
TACATTTACGATTGCTGTTAACCGTCGTTTTAAAAACGCGCAAGGCGAACGTGAAGCTGATTTCATTAACTGTGTCATCT
GGCGTCAATCTGCTGAAAACTTGGCAAATTGGGCTAAAAAAGGTGCCTTGATTGGTGTAACAGGTAGCATTCAAATGCGA
AATTATGAGAACAAAGAAGGTCAACGTGTTTACGTGACTGAAGTATTGGCTGATAACTTCCAAATGCTTGAGAGTCGTGC
CGCACGTGAAGGTGGCTCTGGTTCATATTCTGCACCACAGCAACAACAATCACAAAATCGTCCTTTTGCTGGCTCTAACA
GCTCAGCAGGAAATGCAACACCTGATTTTGGTCGTGATGCAGATCCATTTGGTGGCTCACCAATGGAAATCTCAGATGAT
GATCTTCCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
57.31 |
100 |
0.598 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
53.933 |
100 |
0.585 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
49.242 |
80.488 |
0.396 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
48.485 |
80.488 |
0.39 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
48.485 |
80.488 |
0.39 |
| ssbB/cilA | Streptococcus mitis SK321 |
48.485 |
80.488 |
0.39 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
48.485 |
80.488 |
0.39 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
48.485 |
80.488 |
0.39 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
57.547 |
64.634 |
0.372 |