Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | VNN47_RS06300 | Genome accession | NZ_CP141709 |
| Coordinates | 1258030..1258524 (-) | Length | 164 a.a. |
| NCBI ID | WP_407350034.1 | Uniprot ID | - |
| Organism | Lactococcus garvieae strain VC13 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1258030..1303938 | 1258030..1258524 | within | 0 |
Gene organization within MGE regions
Location: 1258030..1303938
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| VNN47_RS06300 (VNN47_06275) | ssb | 1258030..1258524 (-) | 495 | WP_407350034.1 | single-stranded DNA-binding protein | Machinery gene |
| VNN47_RS06305 (VNN47_06280) | rpsF | 1258562..1258855 (-) | 294 | WP_003133129.1 | 30S ribosomal protein S6 | - |
| VNN47_RS06310 (VNN47_06285) | - | 1259042..1259254 (-) | 213 | WP_016171080.1 | hypothetical protein | - |
| VNN47_RS06315 (VNN47_06290) | - | 1259724..1261187 (+) | 1464 | WP_003133128.1 | amino acid permease | - |
| VNN47_RS06320 (VNN47_06295) | dnaX | 1261221..1262879 (-) | 1659 | WP_407350035.1 | DNA polymerase III subunit gamma/tau | - |
| VNN47_RS06325 (VNN47_06300) | - | 1262892..1263512 (-) | 621 | WP_407350036.1 | phosphotransferase | - |
| VNN47_RS06330 (VNN47_06305) | - | 1263525..1264004 (-) | 480 | WP_014025504.1 | GAF domain-containing protein | - |
| VNN47_RS06335 (VNN47_06310) | - | 1264476..1264688 (-) | 213 | WP_407350037.1 | hypothetical protein | - |
| VNN47_RS06345 (VNN47_06320) | - | 1265741..1266514 (-) | 774 | WP_407350038.1 | DUF3825 domain-containing protein | - |
| VNN47_RS06350 (VNN47_06325) | - | 1267088..1267789 (-) | 702 | WP_407350039.1 | CHAP domain-containing protein | - |
| VNN47_RS06355 (VNN47_06330) | - | 1267796..1268041 (-) | 246 | WP_407350040.1 | phage holin | - |
| VNN47_RS06360 (VNN47_06335) | - | 1268051..1268362 (-) | 312 | WP_339011347.1 | hypothetical protein | - |
| VNN47_RS06365 (VNN47_06340) | - | 1268363..1269481 (-) | 1119 | WP_407350041.1 | BppU family phage baseplate upper protein | - |
| VNN47_RS06370 (VNN47_06345) | - | 1269463..1271637 (-) | 2175 | WP_407350042.1 | phage tail spike protein | - |
| VNN47_RS06375 (VNN47_06350) | - | 1271634..1272395 (-) | 762 | WP_407350043.1 | distal tail protein Dit | - |
| VNN47_RS06380 (VNN47_06355) | - | 1272395..1275730 (-) | 3336 | WP_407350044.1 | hypothetical protein | - |
| VNN47_RS06385 (VNN47_06360) | - | 1275730..1276320 (-) | 591 | WP_407350045.1 | Gp15 family bacteriophage protein | - |
| VNN47_RS06390 (VNN47_06365) | - | 1276329..1276700 (-) | 372 | WP_407350046.1 | hypothetical protein | - |
| VNN47_RS06395 (VNN47_06370) | - | 1276803..1277228 (-) | 426 | WP_407350047.1 | phage tail tube protein | - |
| VNN47_RS06400 (VNN47_06375) | - | 1277231..1277629 (-) | 399 | WP_407350048.1 | minor capsid protein | - |
| VNN47_RS06405 (VNN47_06380) | - | 1277629..1277982 (-) | 354 | WP_407350049.1 | minor capsid protein | - |
| VNN47_RS06410 (VNN47_06385) | - | 1277982..1278320 (-) | 339 | WP_404883453.1 | hypothetical protein | - |
| VNN47_RS06415 (VNN47_06390) | - | 1278320..1278703 (-) | 384 | WP_407350050.1 | hypothetical protein | - |
| VNN47_RS06420 (VNN47_06395) | - | 1278748..1278969 (-) | 222 | WP_407350051.1 | hypothetical protein | - |
| VNN47_RS06425 (VNN47_06400) | - | 1279039..1279863 (-) | 825 | WP_407350052.1 | N4-gp56 family major capsid protein | - |
| VNN47_RS06430 (VNN47_06405) | - | 1279882..1280481 (-) | 600 | WP_407350053.1 | phage scaffolding protein | - |
| VNN47_RS06440 (VNN47_06415) | - | 1280652..1281860 (-) | 1209 | WP_407350054.1 | phage minor capsid protein | - |
| VNN47_RS06445 (VNN47_06420) | - | 1281863..1283344 (-) | 1482 | WP_407350055.1 | phage portal protein | - |
| VNN47_RS06450 (VNN47_06425) | - | 1283355..1284650 (-) | 1296 | WP_407350986.1 | PBSX family phage terminase large subunit | - |
| VNN47_RS06455 (VNN47_06430) | - | 1284647..1285180 (-) | 534 | WP_407350056.1 | terminase small subunit | - |
| VNN47_RS06460 (VNN47_06435) | - | 1285227..1285823 (-) | 597 | WP_407350057.1 | hypothetical protein | - |
| VNN47_RS06475 (VNN47_06450) | - | 1286723..1287118 (-) | 396 | WP_407350058.1 | DUF722 domain-containing protein | - |
| VNN47_RS06480 (VNN47_06455) | - | 1287248..1287460 (-) | 213 | WP_407350060.1 | hypothetical protein | - |
| VNN47_RS06485 (VNN47_06460) | - | 1287578..1287790 (-) | 213 | WP_407350061.1 | hypothetical protein | - |
| VNN47_RS06490 (VNN47_06465) | - | 1287783..1288265 (-) | 483 | WP_407350999.1 | hypothetical protein | - |
| VNN47_RS06495 (VNN47_06470) | - | 1288271..1288510 (-) | 240 | WP_407350062.1 | helix-turn-helix domain-containing protein | - |
| VNN47_RS06500 (VNN47_06475) | - | 1288503..1288829 (-) | 327 | WP_407350063.1 | hypothetical protein | - |
| VNN47_RS06505 (VNN47_06480) | - | 1288833..1288976 (-) | 144 | WP_407350064.1 | hypothetical protein | - |
| VNN47_RS06510 (VNN47_06485) | - | 1289002..1289799 (-) | 798 | WP_407350065.1 | DNA adenine methylase | - |
| VNN47_RS06515 (VNN47_06490) | - | 1289783..1290034 (-) | 252 | WP_407350066.1 | hypothetical protein | - |
| VNN47_RS06520 (VNN47_06495) | - | 1290031..1290333 (-) | 303 | WP_407350067.1 | hypothetical protein | - |
| VNN47_RS06525 (VNN47_06500) | - | 1290330..1290497 (-) | 168 | WP_407350987.1 | DUF6877 family protein | - |
| VNN47_RS06530 (VNN47_06505) | - | 1290772..1290945 (-) | 174 | WP_407350068.1 | hypothetical protein | - |
| VNN47_RS06535 (VNN47_06510) | - | 1291062..1291454 (-) | 393 | WP_407350069.1 | RusA family crossover junction endodeoxyribonuclease | - |
| VNN47_RS06540 (VNN47_06515) | - | 1291451..1291735 (-) | 285 | WP_407350070.1 | hypothetical protein | - |
| VNN47_RS06545 (VNN47_06520) | - | 1291719..1292507 (-) | 789 | WP_407350071.1 | helix-turn-helix domain-containing protein | - |
| VNN47_RS06550 (VNN47_06525) | - | 1292510..1292674 (-) | 165 | WP_339011889.1 | hypothetical protein | - |
| VNN47_RS06555 (VNN47_06530) | - | 1292687..1292905 (-) | 219 | WP_407350072.1 | helix-turn-helix domain-containing protein | - |
| VNN47_RS06560 (VNN47_06535) | - | 1293136..1294131 (-) | 996 | WP_407350073.1 | DUF1351 domain-containing protein | - |
| VNN47_RS06565 (VNN47_06540) | bet | 1294132..1294908 (-) | 777 | WP_407350074.1 | phage recombination protein Bet | - |
| VNN47_RS06570 | - | 1294992..1295174 (-) | 183 | WP_407357373.1 | hypothetical protein | - |
| VNN47_RS06575 (VNN47_06545) | - | 1295195..1295431 (-) | 237 | WP_407350075.1 | DNA-binding protein | - |
| VNN47_RS06580 (VNN47_06550) | - | 1295595..1295792 (+) | 198 | WP_407350076.1 | hypothetical protein | - |
| VNN47_RS06585 (VNN47_06555) | - | 1295831..1296100 (-) | 270 | WP_407350077.1 | hypothetical protein | - |
| VNN47_RS06590 (VNN47_06560) | - | 1296112..1296360 (-) | 249 | WP_407350078.1 | hypothetical protein | - |
| VNN47_RS06595 (VNN47_06565) | - | 1296589..1297389 (+) | 801 | WP_407350079.1 | S24 family peptidase | - |
| VNN47_RS06600 (VNN47_06570) | - | 1297403..1297603 (+) | 201 | WP_407350081.1 | hypothetical protein | - |
| VNN47_RS06605 (VNN47_06575) | - | 1297618..1297821 (+) | 204 | WP_407350082.1 | hypothetical protein | - |
| VNN47_RS06610 (VNN47_06580) | istB | 1297873..1298631 (-) | 759 | WP_341485250.1 | IS21-like element helper ATPase IstB | - |
| VNN47_RS06615 (VNN47_06585) | istA | 1298640..1299863 (-) | 1224 | WP_341485251.1 | IS21 family transposase | - |
| VNN47_RS06620 (VNN47_06590) | - | 1300095..1300655 (+) | 561 | WP_407350083.1 | hypothetical protein | - |
| VNN47_RS06625 (VNN47_06595) | - | 1300699..1301073 (+) | 375 | WP_407350084.1 | PH domain-containing protein | - |
| VNN47_RS06630 (VNN47_06600) | - | 1301197..1302315 (+) | 1119 | WP_407350085.1 | tyrosine-type recombinase/integrase | - |
| VNN47_RS06635 (VNN47_06605) | - | 1302544..1302837 (-) | 294 | WP_042218991.1 | hypothetical protein | - |
| VNN47_RS06640 (VNN47_06610) | - | 1302839..1303105 (-) | 267 | WP_003133123.1 | DUF2089 family protein | - |
| VNN47_RS06645 (VNN47_06615) | - | 1303245..1303514 (+) | 270 | WP_019299134.1 | chorismate mutase | - |
| VNN47_RS06650 (VNN47_06620) | - | 1303507..1303938 (-) | 432 | WP_165706169.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 164 a.a. Molecular weight: 18035.94 Da Isoelectric Point: 4.9533
>NTDB_id=918662 VNN47_RS06300 WP_407350034.1 1258030..1258524(-) (ssb) [Lactococcus garvieae strain VC13]
MINNVVLVGRVVRDPELRYTPQNTAVATFTIAVNRRFKNAQGEREADFINCVIWRQSAENLANWAKKGALIGVTGSIQMR
NYENKEGQRVYVTEVLADNFQMLESRAAREGGSGSYSAPQQQQSQNRPFAGSNSSAGNATPDFGRDADPFGGSPMEISDD
DLPF
MINNVVLVGRVVRDPELRYTPQNTAVATFTIAVNRRFKNAQGEREADFINCVIWRQSAENLANWAKKGALIGVTGSIQMR
NYENKEGQRVYVTEVLADNFQMLESRAAREGGSGSYSAPQQQQSQNRPFAGSNSSAGNATPDFGRDADPFGGSPMEISDD
DLPF
Nucleotide
Download Length: 495 bp
>NTDB_id=918662 VNN47_RS06300 WP_407350034.1 1258030..1258524(-) (ssb) [Lactococcus garvieae strain VC13]
ATGATTAATAATGTTGTTTTGGTCGGACGCGTTGTGCGTGACCCTGAACTGCGATATACACCGCAAAATACTGCGGTTGC
TACATTTACGATTGCTGTTAACCGTCGTTTTAAAAACGCGCAAGGCGAACGTGAAGCTGATTTCATTAACTGTGTCATCT
GGCGTCAATCTGCTGAAAACTTGGCAAATTGGGCTAAAAAAGGTGCCTTGATTGGTGTAACAGGTAGCATTCAAATGCGA
AATTATGAGAACAAAGAAGGTCAACGTGTTTACGTGACTGAAGTATTGGCTGATAACTTCCAAATGCTTGAGAGTCGTGC
CGCACGTGAAGGTGGCTCTGGTTCATATTCTGCACCACAGCAACAACAATCACAAAATCGTCCTTTTGCTGGCTCTAACA
GCTCAGCAGGAAATGCAACACCTGATTTTGGTCGTGATGCAGATCCATTTGGTGGCTCACCAATGGAAATCTCAGATGAT
GATCTTCCATTCTAA
ATGATTAATAATGTTGTTTTGGTCGGACGCGTTGTGCGTGACCCTGAACTGCGATATACACCGCAAAATACTGCGGTTGC
TACATTTACGATTGCTGTTAACCGTCGTTTTAAAAACGCGCAAGGCGAACGTGAAGCTGATTTCATTAACTGTGTCATCT
GGCGTCAATCTGCTGAAAACTTGGCAAATTGGGCTAAAAAAGGTGCCTTGATTGGTGTAACAGGTAGCATTCAAATGCGA
AATTATGAGAACAAAGAAGGTCAACGTGTTTACGTGACTGAAGTATTGGCTGATAACTTCCAAATGCTTGAGAGTCGTGC
CGCACGTGAAGGTGGCTCTGGTTCATATTCTGCACCACAGCAACAACAATCACAAAATCGTCCTTTTGCTGGCTCTAACA
GCTCAGCAGGAAATGCAACACCTGATTTTGGTCGTGATGCAGATCCATTTGGTGGCTCACCAATGGAAATCTCAGATGAT
GATCTTCCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
57.31 |
100 |
0.598 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
53.933 |
100 |
0.585 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
49.242 |
80.488 |
0.396 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
48.485 |
80.488 |
0.39 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
48.485 |
80.488 |
0.39 |
| ssbB/cilA | Streptococcus mitis SK321 |
48.485 |
80.488 |
0.39 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
48.485 |
80.488 |
0.39 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
48.485 |
80.488 |
0.39 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
57.547 |
64.634 |
0.372 |