NTDB

Overview

Name	comGC/cglC	Type	Machinery gene
Locus tag	SE933_RS01515	Genome accession	NZ_CP138370
Coordinates	267911..268240 (-)	Length	109 a.a.
NCBI ID	WP_000793380.1	Uniprot ID	A0A0E1EKJ1
Organism	Streptococcus agalactiae strain SagR40
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 262911..273240

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SE933_RS01470 (SE933_01470)	-	263124..263579 (-)	456	WP_000905673.1	hypothetical protein	-
SE933_RS01475 (SE933_01475)	-	263620..263757 (-)	138	WP_001865900.1	hypothetical protein	-
SE933_RS01480 (SE933_01480)	-	263816..264022 (-)	207	WP_000798241.1	helix-turn-helix transcriptional regulator	-
SE933_RS01485 (SE933_01485)	-	264174..265367 (-)	1194	WP_000047534.1	acetate kinase	-
SE933_RS01490 (SE933_01490)	comYH	265399..266373 (-)	975	WP_001008574.1	class I SAM-dependent methyltransferase	Machinery gene
SE933_RS01495 (SE933_01495)	comGG	266488..266859 (-)	372	WP_000601104.1	competence type IV pilus minor pilin ComGG	-
SE933_RS01500 (SE933_01500)	comGF	266837..267298 (-)	462	WP_001874812.1	competence type IV pilus minor pilin ComGF	-
SE933_RS01505 (SE933_01505)	comGE	267252..267551 (-)	300	WP_000234804.1	competence type IV pilus minor pilin ComGE	-
SE933_RS01510 (SE933_01510)	comYD	267523..267936 (-)	414	WP_000244261.1	competence type IV pilus minor pilin ComGD	Machinery gene
SE933_RS01515 (SE933_01515)	comGC/cglC	267911..268240 (-)	330	WP_000793380.1	competence type IV pilus major pilin ComGC	Machinery gene
SE933_RS01520 (SE933_01520)	comYB	268237..269280 (-)	1044	WP_223295889.1	competence type IV pilus assembly protein ComGB	Machinery gene
SE933_RS01525 (SE933_01525)	comYA	269174..270145 (-)	972	WP_000250805.1	competence type IV pilus ATPase ComGA	Machinery gene
SE933_RS01530 (SE933_01530)	-	270318..270683 (-)	366	WP_000285373.1	DUF1033 family protein	-

Sequence

Protein

Download Length: 109 a.a. Molecular weight: 12129.27 Da Isoelectric Point: 10.0311

                                >NTDB_id=902383 SE933_RS01515 WP_000793380.1 267911..268240(-) (comGC/cglC) [Streptococcus agalactiae strain SagR40]

MKNLLLKCKDKKVKAFTLLEMLVVLIIISVLLLLFVPNLSKQKESVTRTGNAAVVKVVESQAELFELQETGRKASLSTLK

SGGYITEKQEKAYLDYYKDSSNGSQKISS

Nucleotide

Download Length: 330 bp

                                >NTDB_id=902383 SE933_RS01515 WP_000793380.1 267911..268240(-) (comGC/cglC) [Streptococcus agalactiae strain SagR40]

ATGAAAAATTTATTGTTAAAATGTAAGGATAAGAAGGTTAAAGCATTTACACTTTTAGAAATGTTAGTTGTTTTGATCAT

TATTTCGGTCTTGTTGTTATTGTTTGTACCCAATTTATCAAAACAAAAGGAAAGTGTCACAAGAACTGGAAATGCCGCTG

TTGTCAAGGTTGTAGAAAGTCAAGCCGAACTTTTTGAACTGCAAGAAACAGGTAGAAAAGCTAGTTTATCCACTCTAAAA

TCTGGAGGATATATTACTGAAAAGCAAGAAAAAGCCTATTTAGATTATTATAAAGACAGTTCCAATGGTTCTCAGAAAAT

TTCAAGTTAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(11-34)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	A0A0E1EKJ1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGC/cglC	Streptococcus mitis NCTC 12261	60.55	100	0.606
comGC/cglC	Streptococcus mitis SK321	59.633	100	0.596
comYC	Streptococcus gordonii str. Challis substr. CH1	61.165	94.495	0.578
comGC/cglC	Streptococcus pneumoniae TIGR4	57.798	100	0.578
comGC/cglC	Streptococcus pneumoniae R6	57.798	100	0.578
comGC/cglC	Streptococcus pneumoniae Rx1	57.798	100	0.578
comGC/cglC	Streptococcus pneumoniae D39	57.798	100	0.578
comYC	Streptococcus mutans UA159	55.238	96.33	0.532
comYC	Streptococcus mutans UA140	55.238	96.33	0.532
comGC	Lactococcus lactis subsp. cremoris KW2	63.043	84.404	0.532
comYC	Streptococcus suis isolate S10	65.854	75.229	0.495

Detailed information NTG0902383