Detailed information
Overview
| Name | comC/comC1 | Type | Regulator |
| Locus tag | R1Y14_RS01815 | Genome accession | NZ_CP136899 |
| Coordinates | 333311..333436 (-) | Length | 41 a.a. |
| NCBI ID | WP_000799689.1 | Uniprot ID | P60242 |
| Organism | Streptococcus pneumoniae strain ST62 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 328311..338436
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| R1Y14_RS01785 (R1Y14_01785) | - | 328671..330303 (-) | 1633 | Protein_315 | YhgE/Pip family protein | - |
| R1Y14_RS01790 (R1Y14_01790) | - | 330431..330973 (+) | 543 | WP_001158266.1 | TetR/AcrR family transcriptional regulator | - |
| R1Y14_RS01805 (R1Y14_01805) | comE | 331216..331968 (-) | 753 | WP_000866065.1 | competence system response regulator transcription factor ComE | Regulator |
| R1Y14_RS01810 (R1Y14_01810) | comD/comD1 | 331965..333290 (-) | 1326 | WP_001860404.1 | competence system sensor histidine kinase ComD | Regulator |
| R1Y14_RS01815 (R1Y14_01815) | comC/comC1 | 333311..333436 (-) | 126 | WP_000799689.1 | competence-stimulating peptide ComC | Regulator |
| R1Y14_RS01825 (R1Y14_01825) | rlmH | 333719..334198 (-) | 480 | WP_000695929.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| R1Y14_RS01830 (R1Y14_01830) | htrA | 334381..335562 (+) | 1182 | WP_000681601.1 | S1C family serine protease | Regulator |
| R1Y14_RS01835 (R1Y14_01835) | spo0J | 335620..336378 (+) | 759 | WP_000410378.1 | ParB/RepB/Spo0J family partition protein | Regulator |
| R1Y14_RS01840 (R1Y14_01840) | dnaA | 336591..337952 (+) | 1362 | WP_000660615.1 | chromosomal replication initiator protein DnaA | - |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4971.00 Da Isoelectric Point: 11.0775
>NTDB_id=893226 R1Y14_RS01815 WP_000799689.1 333311..333436(-) (comC/comC1) [Streptococcus pneumoniae strain ST62]
MKNTVKLEQFVALKEKDLQKIKGGEMRLSKFFRDFILQRKK
MKNTVKLEQFVALKEKDLQKIKGGEMRLSKFFRDFILQRKK
Nucleotide
Download Length: 126 bp
>NTDB_id=893226 R1Y14_RS01815 WP_000799689.1 333311..333436(-) (comC/comC1) [Streptococcus pneumoniae strain ST62]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GCTGTCAAAATTCTTCCGTGATTTTATTTTACAAAGAAAAAAGTAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GCTGTCAAAATTCTTCCGTGATTTTATTTTACAAAGAAAAAAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC1 | Streptococcus pneumoniae R6 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae G54 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae D39 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
100 |
100 |
1 |
| comC/comC2 | Streptococcus pneumoniae A66 |
80.488 |
100 |
0.805 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
80.488 |
100 |
0.805 |
| comC | Streptococcus mitis SK321 |
78.049 |
100 |
0.78 |
| comC | Streptococcus mitis NCTC 12261 |
74.074 |
65.854 |
0.488 |
| comC/blpC | Streptococcus mutans UA159 |
44.444 |
87.805 |
0.39 |