Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | QM318_RS14210 | Genome accession | NZ_CP125867 |
| Coordinates | 2840508..2840978 (+) | Length | 156 a.a. |
| NCBI ID | WP_000934753.1 | Uniprot ID | A0A1S5YP95 |
| Organism | Staphylococcus aureus strain 19-02247 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2822897..2846722 | 2840508..2840978 | within | 0 |
Gene organization within MGE regions
Location: 2822897..2846722
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QM318_RS14080 (QM318_14080) | - | 2822897..2823742 (+) | 846 | WP_000812010.1 | class I SAM-dependent methyltransferase | - |
| QM318_RS14085 (QM318_14085) | - | 2824114..2825337 (-) | 1224 | WP_000206639.1 | ArgE/DapE family deacylase | - |
| QM318_RS14090 (QM318_14090) | lukH | 2825772..2826827 (+) | 1056 | WP_000791407.1 | bi-component leukocidin LukGH subunit H | - |
| QM318_RS14095 (QM318_14095) | lukG | 2826849..2827865 (+) | 1017 | WP_000595324.1 | bi-component leukocidin LukGH subunit G | - |
| QM318_RS14100 (QM318_14100) | sph | 2828103..2828933 (-) | 831 | Protein_2737 | sphingomyelin phosphodiesterase | - |
| QM318_RS14105 (QM318_14105) | - | 2828984..2830021 (-) | 1038 | WP_000857199.1 | site-specific integrase | - |
| QM318_RS14110 (QM318_14110) | - | 2830212..2830925 (-) | 714 | WP_001549185.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| QM318_RS14115 (QM318_14115) | - | 2831003..2831185 (-) | 183 | WP_000705246.1 | hypothetical protein | - |
| QM318_RS14120 (QM318_14120) | - | 2831389..2831730 (-) | 342 | WP_000591749.1 | hypothetical protein | - |
| QM318_RS14125 (QM318_14125) | - | 2831736..2832668 (-) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| QM318_RS14130 (QM318_14130) | - | 2832684..2833397 (-) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| QM318_RS14135 (QM318_14135) | - | 2833360..2833533 (+) | 174 | WP_001801500.1 | hypothetical protein | - |
| QM318_RS14140 (QM318_14140) | - | 2833530..2833793 (+) | 264 | WP_000854072.1 | helix-turn-helix transcriptional regulator | - |
| QM318_RS14145 (QM318_14145) | - | 2833809..2834024 (+) | 216 | WP_001025404.1 | MW1434 family type I TA system toxin | - |
| QM318_RS14150 (QM318_14150) | - | 2834013..2834342 (-) | 330 | WP_000180411.1 | hypothetical protein | - |
| QM318_RS14155 (QM318_14155) | - | 2834393..2835145 (+) | 753 | WP_001148642.1 | phage antirepressor KilAC domain-containing protein | - |
| QM318_RS14160 (QM318_14160) | - | 2835161..2835337 (+) | 177 | WP_001001356.1 | hypothetical protein | - |
| QM318_RS14165 (QM318_14165) | - | 2835334..2835564 (-) | 231 | WP_000549548.1 | hypothetical protein | - |
| QM318_RS14170 (QM318_14170) | - | 2835623..2835943 (+) | 321 | WP_001120199.1 | DUF771 domain-containing protein | - |
| QM318_RS14175 (QM318_14175) | - | 2835940..2836101 (+) | 162 | WP_001285960.1 | DUF1270 domain-containing protein | - |
| QM318_RS14180 (QM318_14180) | - | 2836196..2836515 (+) | 320 | Protein_2753 | DUF2482 family protein | - |
| QM318_RS14185 (QM318_14185) | - | 2836496..2836756 (+) | 261 | WP_000291513.1 | DUF1108 family protein | - |
| QM318_RS14190 (QM318_14190) | - | 2836765..2837028 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| QM318_RS14195 (QM318_14195) | - | 2837037..2838887 (+) | 1851 | WP_342626458.1 | ATPase | - |
| QM318_RS14200 (QM318_14200) | - | 2838889..2839809 (+) | 921 | WP_000138475.1 | recombinase RecT | - |
| QM318_RS14205 (QM318_14205) | - | 2839890..2840507 (+) | 618 | WP_071665632.1 | MBL fold metallo-hydrolase | - |
| QM318_RS14210 (QM318_14210) | ssbA | 2840508..2840978 (+) | 471 | WP_000934753.1 | single-stranded DNA-binding protein | Machinery gene |
| QM318_RS14215 (QM318_14215) | - | 2841008..2841901 (+) | 894 | WP_000148333.1 | DnaD domain-containing protein | - |
| QM318_RS14220 (QM318_14220) | - | 2841908..2842126 (+) | 219 | WP_000338530.1 | hypothetical protein | - |
| QM318_RS14225 (QM318_14225) | - | 2842135..2842539 (+) | 405 | WP_000401977.1 | RusA family crossover junction endodeoxyribonuclease | - |
| QM318_RS14230 (QM318_14230) | - | 2842552..2842920 (+) | 369 | WP_000101288.1 | SA1788 family PVL leukocidin-associated protein | - |
| QM318_RS14235 (QM318_14235) | - | 2842924..2843166 (+) | 243 | WP_000131383.1 | phi PVL orf 51-like protein | - |
| QM318_RS14240 (QM318_14240) | - | 2843175..2843546 (+) | 372 | WP_001549172.1 | hypothetical protein | - |
| QM318_RS14245 (QM318_14245) | - | 2843539..2843775 (+) | 237 | WP_001065101.1 | DUF1024 family protein | - |
| QM318_RS14250 (QM318_14250) | - | 2843765..2844007 (+) | 243 | WP_000700108.1 | hypothetical protein | - |
| QM318_RS14255 (QM318_14255) | - | 2844000..2844533 (+) | 534 | WP_000181819.1 | dUTP pyrophosphatase | - |
| QM318_RS14260 (QM318_14260) | - | 2844570..2844815 (+) | 246 | WP_001282074.1 | hypothetical protein | - |
| QM318_RS14265 (QM318_14265) | - | 2844812..2845018 (+) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| QM318_RS14270 (QM318_14270) | - | 2845015..2845401 (+) | 387 | WP_000592207.1 | hypothetical protein | - |
| QM318_RS14275 (QM318_14275) | - | 2845398..2845547 (+) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| QM318_RS14280 (QM318_14280) | - | 2845547..2845747 (+) | 201 | WP_000265043.1 | DUF1514 family protein | - |
| QM318_RS14285 (QM318_14285) | - | 2845775..2846191 (+) | 417 | WP_000590122.1 | hypothetical protein | - |
| QM318_RS14290 (QM318_14290) | - | 2846423..2846722 (+) | 300 | WP_000988336.1 | HNH endonuclease | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17668.55 Da Isoelectric Point: 5.2672
>NTDB_id=833209 QM318_RS14210 WP_000934753.1 2840508..2840978(+) (ssbA) [Staphylococcus aureus strain 19-02247]
MLNRTILVGRLTRDPELRTTQNGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MLNRTILVGRLTRDPELRTTQNGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=833209 QM318_RS14210 WP_000934753.1 2840508..2840978(+) (ssbA) [Staphylococcus aureus strain 19-02247]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAATGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAATGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
56.497 |
100 |
0.641 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50 |
100 |
0.545 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
33.333 |
100 |
0.378 |
| ssb | Neisseria meningitidis MC58 |
33.526 |
100 |
0.372 |
| ssb | Neisseria gonorrhoeae MS11 |
33.526 |
100 |
0.372 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
47.5 |
76.923 |
0.365 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
47.5 |
76.923 |
0.365 |