Detailed information
Bioinformatically predicted
Overview
| Name | comC/comC2 | Type | Regulator |
| Locus tag | P8P68_RS07150 | Genome accession | NZ_CP121467 |
| Coordinates | 1457718..1457843 (+) | Length | 41 a.a. |
| NCBI ID | WP_000799678.1 | Uniprot ID | - |
| Organism | Streptococcus sp. D7B5 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 1457864..1466067 | 1457718..1457843 | flank | 21 |
Gene organization within MGE regions
Location: 1457718..1466067
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8P68_RS07150 (P8P68_07150) | comC/comC2 | 1457718..1457843 (+) | 126 | WP_000799678.1 | competence-stimulating peptide ComC | Regulator |
| P8P68_RS07155 (P8P68_07155) | comD | 1457864..1459183 (+) | 1320 | WP_049490808.1 | competence system sensor histidine kinase ComD | Regulator |
| P8P68_RS07160 (P8P68_07160) | comE | 1459180..1459932 (+) | 753 | WP_000866079.1 | competence system response regulator transcription factor ComE | Regulator |
| P8P68_RS07175 (P8P68_07175) | - | 1460168..1460710 (-) | 543 | WP_049477913.1 | TetR-like C-terminal domain-containing protein | - |
| P8P68_RS07180 (P8P68_07180) | - | 1460839..1463493 (+) | 2655 | WP_278275813.1 | YhgE/Pip domain-containing protein | - |
| P8P68_RS07185 (P8P68_07185) | - | 1463515..1466067 (-) | 2553 | WP_000834499.1 | YfhO family protein | - |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4960.73 Da Isoelectric Point: 10.3052
>NTDB_id=812243 P8P68_RS07150 WP_000799678.1 1457718..1457843(+) (comC/comC2) [Streptococcus sp. D7B5]
MKNTVKLEQFKEVTEAELQEIRGGDWRISETIRNLIFPRRK
MKNTVKLEQFKEVTEAELQEIRGGDWRISETIRNLIFPRRK
Nucleotide
Download Length: 126 bp
>NTDB_id=812243 P8P68_RS07150 WP_000799678.1 1457718..1457843(+) (comC/comC2) [Streptococcus sp. D7B5]
ATGAAAAATACAGTAAAGTTGGAACAATTTAAAGAGGTAACAGAGGCAGAATTGCAGGAGATTCGGGGTGGAGATTGGAG
AATTTCAGAAACAATTCGTAATCTTATTTTTCCAAGAAGAAAGTAA
ATGAAAAATACAGTAAAGTTGGAACAATTTAAAGAGGTAACAGAGGCAGAATTGCAGGAGATTCGGGGTGGAGATTGGAG
AATTTCAGAAACAATTCGTAATCTTATTTTTCCAAGAAGAAAGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC2 | Streptococcus pneumoniae A66 |
56.098 |
100 |
0.561 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
56.098 |
100 |
0.561 |
| comC | Streptococcus mitis SK321 |
56.098 |
100 |
0.561 |
| comC/comC1 | Streptococcus pneumoniae R6 |
53.659 |
100 |
0.537 |
| comC/comC1 | Streptococcus pneumoniae G54 |
53.659 |
100 |
0.537 |
| comC/comC1 | Streptococcus pneumoniae D39 |
53.659 |
100 |
0.537 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
53.659 |
100 |
0.537 |
| comC | Streptococcus mitis NCTC 12261 |
47.5 |
97.561 |
0.463 |
| comC/comC2 | Streptococcus gordonii strain NCTC7865 |
43.243 |
90.244 |
0.39 |
| comC/comC1 | Streptococcus gordonii str. Challis substr. CH1 |
39.474 |
92.683 |
0.366 |