Detailed information NTG0810842

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: P8F79_RS07110
• Genome accession: NZ_CP121172
• Coordinates: 1423168..1423485 (+)
• Length: 105 a.a.
• NCBI ID: WP_037588275.1
• Uniprot ID: -
• Organism: Mammaliicoccus sciuri strain PC04
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1418168..1428485

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
P8F79_RS07070 (P8F79_07065)	-	1418313..1418504 (+)	192	WP_078099923.1	YqgQ family protein	-
P8F79_RS07075 (P8F79_07070)	-	1418501..1419472 (+)	972	WP_048539719.1	ROK family glucokinase	-
P8F79_RS07080 (P8F79_07075)	-	1419472..1419786 (+)	315	WP_048539720.1	MTH1187 family thiamine-binding protein	-
P8F79_RS07085 (P8F79_07080)	-	1419815..1420054 (-)	240	WP_016911885.1	DUF2759 domain-containing protein	-
P8F79_RS07090 (P8F79_07085)	-	1420152..1420784 (+)	633	WP_048539721.1	MBL fold metallo-hydrolase	-
P8F79_RS07095 (P8F79_07090)	-	1420819..1421067 (-)	249	WP_025904960.1	DUF2626 family protein	-
P8F79_RS07100 (P8F79_07095)	comGA	1421221..1422123 (+)	903	WP_048539722.1	competence type IV pilus ATPase ComGA	Machinery gene
P8F79_RS07105 (P8F79_07100)	comGB	1422113..1423153 (+)	1041	WP_075577987.1	competence type IV pilus assembly protein ComGB	-
P8F79_RS07110 (P8F79_07105)	comGC	1423168..1423485 (+)	318	WP_037588275.1	competence type IV pilus major pilin ComGC	Machinery gene
P8F79_RS07115 (P8F79_07110)	comGD	1423463..1423912 (+)	450	WP_048539818.1	competence type IV pilus minor pilin ComGD	-
P8F79_RS07120 (P8F79_07115)	comGE	1423896..1424177 (+)	282	WP_048539723.1	competence type IV pilus minor pilin ComGE	-
P8F79_RS07125 (P8F79_07120)	-	1424152..1424586 (+)	435	WP_048539724.1	prepilin-type N-terminal cleavage/methylation domain-containing protein	-
P8F79_RS07130 (P8F79_07125)	-	1424821..1425309 (+)	489	WP_048539725.1	shikimate kinase	-
P8F79_RS07135 (P8F79_07130)	gcvT	1425502..1426590 (+)	1089	WP_048539726.1	glycine cleavage system aminomethyltransferase GcvT	-
P8F79_RS07140 (P8F79_07135)	gcvPA	1426602..1427945 (+)	1344	WP_048539727.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11591.65 Da
• Isoelectric Point: 8.5043

>NTDB_id=810842 P8F79_RS07110 WP_037588275.1 1423168..1423485(+) (comGC) [Mammaliicoccus sciuri strain PC04]
MKRFKFLSKKEGFTLVEMLIVLLIISILLVIIIPNISKQSETVKSTGCQAQVKMVAGQVEAYTLKHDAKPNSINDLVSDG
YINQKQLTCKSGETITLENGEVVAH

Nucleotide

• Length: 318 bp

>NTDB_id=810842 P8F79_RS07110 WP_037588275.1 1423168..1423485(+) (comGC) [Mammaliicoccus sciuri strain PC04]
ATGAAAAGATTTAAATTTTTAAGTAAAAAAGAAGGATTTACATTGGTTGAGATGCTAATTGTCCTTTTAATCATAAGTAT
ATTATTGGTGATCATCATACCAAACATAAGTAAGCAATCAGAGACTGTAAAAAGTACTGGATGCCAAGCTCAAGTGAAAA
TGGTTGCTGGTCAAGTAGAAGCTTATACATTGAAGCACGACGCTAAACCAAATTCTATAAATGATTTAGTAAGTGATGGT
TATATTAATCAAAAGCAACTGACATGTAAATCAGGTGAGACAATTACACTTGAAAATGGTGAAGTTGTTGCACATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-32)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	64.706	97.143	0.629
comGC	Staphylococcus aureus MW2	64.706	97.143	0.629
comGC	Bacillus subtilis subsp. subtilis str. 168	47.312	88.571	0.419
comYC	Streptococcus mutans UA159	49.425	82.857	0.41
comYC	Streptococcus mutans UA140	49.425	82.857	0.41
comYC	Streptococcus gordonii str. Challis substr. CH1	48.837	81.905	0.4
comGC/cglC	Streptococcus mitis NCTC 12261	46.988	79.048	0.371
comGC/cglC	Streptococcus mitis SK321	46.988	79.048	0.371
comGC	Lactococcus lactis subsp. cremoris KW2	46.914	77.143	0.362
comYC	Streptococcus suis isolate S10	48.718	74.286	0.362