Detailed information
Bioinformatically predicted
Overview
| Name | comFC | Type | Machinery gene |
| Locus tag | P5638_RS05730 | Genome accession | NZ_CP120599 |
| Coordinates | 1161824..1161979 (+) | Length | 51 a.a. |
| NCBI ID | WP_277722747.1 | Uniprot ID | - |
| Organism | Bacillus safensis strain PRO114 | ||
| Function | ssDNA transport into the cell (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1156824..1166979
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P5638_RS05705 (P5638_05705) | degU | 1157690..1158379 (+) | 690 | WP_008348273.1 | two-component system response regulator DegU | Regulator |
| P5638_RS05710 (P5638_05710) | - | 1158595..1159437 (+) | 843 | WP_277722743.1 | DegV family protein | - |
| P5638_RS05715 (P5638_05715) | comFA | 1159558..1160955 (+) | 1398 | WP_277722972.1 | DEAD/DEAH box helicase | Machinery gene |
| P5638_RS05720 (P5638_05720) | - | 1161004..1161297 (+) | 294 | WP_024426256.1 | competence protein ComFB | - |
| P5638_RS05725 (P5638_05725) | - | 1161324..1161812 (+) | 489 | WP_277722745.1 | double zinc ribbon domain-containing protein | - |
| P5638_RS05730 (P5638_05730) | comFC | 1161824..1161979 (+) | 156 | WP_277722747.1 | phosphoribosyltransferase family protein | Machinery gene |
| P5638_RS05735 (P5638_05735) | - | 1162036..1162455 (+) | 420 | WP_024423621.1 | TIGR03826 family flagellar region protein | - |
| P5638_RS05740 (P5638_05740) | flgM | 1162535..1162798 (+) | 264 | WP_024423620.1 | flagellar biosynthesis anti-sigma factor FlgM | - |
| P5638_RS05745 (P5638_05745) | - | 1162817..1163299 (+) | 483 | WP_034623751.1 | flagellar protein FlgN | - |
| P5638_RS05750 (P5638_05750) | flgK | 1163315..1164835 (+) | 1521 | WP_024423618.1 | flagellar hook-associated protein FlgK | - |
| P5638_RS05755 (P5638_05755) | flgL | 1164845..1165753 (+) | 909 | WP_024423617.1 | flagellar hook-associated protein FlgL | - |
| P5638_RS05760 (P5638_05760) | - | 1165800..1166378 (+) | 579 | WP_024426253.1 | DUF6470 family protein | - |
| P5638_RS05765 (P5638_05765) | fliW | 1166407..1166841 (+) | 435 | WP_024423615.1 | flagellar assembly protein FliW | - |
Sequence
Protein
Download Length: 51 a.a. Molecular weight: 5634.49 Da Isoelectric Point: 6.1124
>NTDB_id=806495 P5638_RS05730 WP_277722747.1 1161824..1161979(+) (comFC) [Bacillus safensis strain PRO114]
MFQIKQTDAIVQRDIILVDDIYTTGATIYDAARILKDAGAKSVSSFTLIRS
MFQIKQTDAIVQRDIILVDDIYTTGATIYDAARILKDAGAKSVSSFTLIRS
Nucleotide
Download Length: 156 bp
>NTDB_id=806495 P5638_RS05730 WP_277722747.1 1161824..1161979(+) (comFC) [Bacillus safensis strain PRO114]
TTGTTTCAAATAAAGCAAACAGATGCGATTGTTCAAAGGGATATTATATTAGTTGATGATATCTATACAACGGGAGCAAC
CATCTATGATGCGGCAAGAATTTTGAAAGACGCAGGTGCTAAAAGTGTTTCTTCTTTTACGTTGATACGTAGTTAA
TTGTTTCAAATAAAGCAAACAGATGCGATTGTTCAAAGGGATATTATATTAGTTGATGATATCTATACAACGGGAGCAAC
CATCTATGATGCGGCAAGAATTTTGAAAGACGCAGGTGCTAAAAGTGTTTCTTCTTTTACGTTGATACGTAGTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comFC | Bacillus subtilis subsp. subtilis str. 168 |
69.231 |
76.471 |
0.529 |
| comFC | Lactococcus lactis subsp. cremoris KW2 |
46.939 |
96.078 |
0.451 |
| comFC/cflB | Streptococcus pneumoniae D39 |
46.667 |
88.235 |
0.412 |
| comFC/cflB | Streptococcus pneumoniae R6 |
46.667 |
88.235 |
0.412 |
| comFC/cflB | Streptococcus pneumoniae TIGR4 |
46.667 |
88.235 |
0.412 |
| comFC/cflB | Streptococcus pneumoniae Rx1 |
46.667 |
88.235 |
0.412 |
| comFC/cflB | Streptococcus mitis SK321 |
47.5 |
78.431 |
0.373 |
| comFC/cflB | Streptococcus mitis NCTC 12261 |
42.222 |
88.235 |
0.373 |