Detailed information NTG0803389

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: P3U32_RS06290
• Genome accession: NZ_CP120131
• Coordinates: 1243804..1244121 (+)
• Length: 105 a.a.
• NCBI ID: WP_323704762.1
• Uniprot ID: -
• Organism: Mammaliicoccus sp. Dog046
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1238804..1249121

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
P3U32_RS06250 (P3U32_06250)	-	1238874..1239065 (+)	192	WP_323704754.1	YqgQ family protein	-
P3U32_RS06255 (P3U32_06255)	-	1239062..1240033 (+)	972	WP_323704755.1	ROK family glucokinase	-
P3U32_RS06260 (P3U32_06260)	-	1240033..1240347 (+)	315	WP_323704756.1	MTH1187 family thiamine-binding protein	-
P3U32_RS06265 (P3U32_06265)	-	1240407..1240646 (-)	240	WP_323704757.1	DUF2759 domain-containing protein	-
P3U32_RS06270 (P3U32_06270)	-	1240743..1241375 (+)	633	WP_323704758.1	MBL fold metallo-hydrolase	-
P3U32_RS06275 (P3U32_06275)	-	1241457..1241702 (-)	246	WP_016911887.1	DUF2626 family protein	-
P3U32_RS06280 (P3U32_06280)	comGA	1241857..1242750 (+)	894	WP_323704759.1	competence type IV pilus ATPase ComGA	-
P3U32_RS06285 (P3U32_06285)	comGB	1242752..1243789 (+)	1038	WP_323704761.1	competence type IV pilus assembly protein ComGB	-
P3U32_RS06290 (P3U32_06290)	comGC	1243804..1244121 (+)	318	WP_323704762.1	competence type IV pilus major pilin ComGC	Machinery gene
P3U32_RS06295 (P3U32_06295)	comGD	1244121..1244546 (+)	426	WP_323704763.1	competence type IV pilus minor pilin ComGD	-
P3U32_RS06300 (P3U32_06300)	comGE	1244536..1244814 (+)	279	WP_323704764.1	competence type IV pilus minor pilin ComGE	-
P3U32_RS06305 (P3U32_06305)	-	1244828..1245223 (+)	396	WP_323704765.1	competence type IV pilus minor pilin ComGF	-
P3U32_RS06310 (P3U32_06310)	-	1245204..1245380 (+)	177	WP_323704766.1	hypothetical protein	-
P3U32_RS06315 (P3U32_06315)	-	1245457..1245945 (+)	489	WP_323704767.1	shikimate kinase	-
P3U32_RS06320 (P3U32_06320)	gcvT	1246137..1247225 (+)	1089	WP_323704768.1	glycine cleavage system aminomethyltransferase GcvT	-
P3U32_RS06325 (P3U32_06325)	gcvPA	1247237..1248580 (+)	1344	WP_323704769.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11576.67 Da
• Isoelectric Point: 8.4982

>NTDB_id=803389 P3U32_RS06290 WP_323704762.1 1243804..1244121(+) (comGC) [Mammaliicoccus sp. Dog046]
MKKLLFISKKEGFTLIEMLIVLLIISILLIIIIPNISKQSETVKSTGCQAQVKMVAGQVEAYTLKHESKPNSVNDLVSDG
YINDKQLTCKSGERITIQNGEVVAN

Nucleotide

• Length: 318 bp

>NTDB_id=803389 P3U32_RS06290 WP_323704762.1 1243804..1244121(+) (comGC) [Mammaliicoccus sp. Dog046]
TTGAAAAAACTATTGTTCATAAGTAAAAAGGAAGGTTTCACTTTAATCGAAATGTTAATTGTACTTTTGATAATCAGTAT
TTTGTTAATCATTATTATTCCTAACATTTCAAAGCAATCTGAGACTGTTAAATCTACTGGATGCCAAGCTCAAGTTAAAA
TGGTGGCAGGTCAAGTAGAAGCTTATACACTTAAACACGAATCAAAGCCAAACTCAGTTAATGATTTGGTAAGTGATGGA
TATATCAATGATAAACAACTTACTTGTAAATCCGGCGAAAGAATAACGATTCAAAATGGCGAAGTAGTTGCAAATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-32)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	65	95.238	0.619
comGC	Staphylococcus aureus MW2	65	95.238	0.619
comGC	Bacillus subtilis subsp. subtilis str. 168	49.462	88.571	0.438
comGC/cglC	Streptococcus mitis SK321	41.748	98.095	0.41
comGC/cglC	Streptococcus pneumoniae D39	40.777	98.095	0.4
comGC/cglC	Streptococcus pneumoniae R6	40.777	98.095	0.4
comGC/cglC	Streptococcus pneumoniae Rx1	40.777	98.095	0.4
comGC/cglC	Streptococcus pneumoniae TIGR4	40.777	98.095	0.4
comYC	Streptococcus mutans UA159	47.674	81.905	0.39
comYC	Streptococcus suis isolate S10	47.674	81.905	0.39
comYC	Streptococcus mutans UA140	47.674	81.905	0.39
comGC/cglC	Streptococcus mitis NCTC 12261	44.944	84.762	0.381