NTDB

Overview

Name	comGC	Type	Machinery gene
Locus tag	P3U29_RS06430	Genome accession	NZ_CP120073
Coordinates	1294876..1295187 (+)	Length	103 a.a.
NCBI ID	WP_011303023.1	Uniprot ID	-
Organism	Staphylococcus saprophyticus strain Dog122
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1289876..1300187

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
P3U29_RS06395 (P3U29_06390)	-	1290613..1290810 (+)	198	WP_037538382.1	YqgQ family protein	-
P3U29_RS06400 (P3U29_06395)	-	1290814..1291800 (+)	987	WP_069973349.1	glucokinase	-
P3U29_RS06405 (P3U29_06400)	-	1291800..1292126 (+)	327	WP_002483185.1	MTH1187 family thiamine-binding protein	-
P3U29_RS06410 (P3U29_06405)	-	1292126..1292749 (+)	624	WP_011303020.1	MBL fold metallo-hydrolase	-
P3U29_RS06415 (P3U29_06410)	comGA	1292837..1293811 (+)	975	WP_011303021.1	competence type IV pilus ATPase ComGA	Machinery gene
P3U29_RS06420 (P3U29_06415)	-	1293858..1294121 (+)	264	WP_323709809.1	hypothetical protein	-
P3U29_RS06425 (P3U29_06420)	comGB	1294096..1294848 (+)	753	WP_323709810.1	competence type IV pilus assembly protein ComGB	-
P3U29_RS06430 (P3U29_06425)	comGC	1294876..1295187 (+)	312	WP_011303023.1	competence type IV pilus major pilin ComGC	Machinery gene
P3U29_RS06435 (P3U29_06430)	comGD	1295165..1295623 (+)	459	WP_169932327.1	competence type IV pilus minor pilin ComGD	-
P3U29_RS06440 (P3U29_06435)	comGF	1295881..1296324 (+)	444	WP_011303025.1	competence type IV pilus minor pilin ComGF	-
P3U29_RS06445 (P3U29_06440)	-	1296528..1297001 (+)	474	WP_002483192.1	shikimate kinase	-
P3U29_RS06450 (P3U29_06445)	gcvT	1297185..1298276 (+)	1092	WP_011303027.1	glycine cleavage system aminomethyltransferase GcvT	-
P3U29_RS06455 (P3U29_06450)	gcvPA	1298294..1299646 (+)	1353	WP_011303028.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

Download Length: 103 a.a. Molecular weight: 11372.45 Da Isoelectric Point: 9.1187

                                >NTDB_id=802544 P3U29_RS06430 WP_011303023.1 1294876..1295187(+) (comGC) [Staphylococcus saprophyticus strain Dog122]

MKKLKINRNAFTLIEMLLVLLIISLLLILIIPNIAKQSSHLQNTGCEAQLKMIDSQIEAYALKFNKKPSSIEDLVTEGYI

KENQKSCKSGAAITINNGEAVAN

Nucleotide

Download Length: 312 bp

                                >NTDB_id=802544 P3U29_RS06430 WP_011303023.1 1294876..1295187(+) (comGC) [Staphylococcus saprophyticus strain Dog122]

ATGAAAAAACTAAAAATTAATAGAAATGCTTTTACATTAATAGAAATGTTACTTGTATTATTAATAATTAGCTTATTATT

AATATTAATTATACCCAATATAGCTAAACAATCGTCTCATTTGCAAAATACTGGATGTGAGGCACAACTTAAAATGATTG

ATAGCCAAATTGAAGCGTATGCTTTAAAGTTTAATAAAAAGCCATCGTCTATAGAAGACTTAGTTACAGAAGGATACATT

AAAGAAAATCAAAAGTCATGTAAATCTGGTGCAGCCATCACTATTAACAATGGTGAAGCTGTTGCAAATTAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(7-30)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGC	Staphylococcus aureus N315	78.723	91.262	0.718
comGC	Staphylococcus aureus MW2	78.723	91.262	0.718
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	100	0.437
comYC	Streptococcus mutans UA159	48.837	83.495	0.408
comYC	Streptococcus mutans UA140	48.837	83.495	0.408
comGC/cglC	Streptococcus mitis NCTC 12261	39.806	100	0.398
comGC	Bacillus subtilis subsp. subtilis str. 168	41.489	91.262	0.379
comYC	Streptococcus suis isolate S10	44.706	82.524	0.369
comGC/cglC	Streptococcus mitis SK321	45.238	81.553	0.369

Detailed information NTG0802544