NTDB

Overview

Name	comGF/cglF	Type	Machinery gene
Locus tag	PW252_RS00710	Genome accession	NZ_CP118735
Coordinates	111943..112377 (+)	Length	144 a.a.
NCBI ID	WP_248049590.1	Uniprot ID	A0AA97A4Z7
Organism	Streptococcus iners strain 29887
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 106943..117377

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PW252_RS00680 (PW252_00680)	-	108086..109036 (-)	951	WP_248049579.1	S66 peptidase family protein	-
PW252_RS00685 (PW252_00685)	comYA	109121..110071 (+)	951	WP_248049581.1	competence type IV pilus ATPase ComGA	Machinery gene
PW252_RS00690 (PW252_00690)	comYB	109983..111020 (+)	1038	WP_248049583.1	competence type IV pilus assembly protein ComGB	Machinery gene
PW252_RS00695 (PW252_00695)	comYC	111022..111303 (+)	282	WP_248049584.1	competence type IV pilus major pilin ComGC	Machinery gene
PW252_RS00700 (PW252_00700)	comGD	111284..111691 (+)	408	WP_248049586.1	competence type IV pilus minor pilin ComGD	-
PW252_RS00705 (PW252_00705)	comYE	111663..111956 (+)	294	WP_248049588.1	competence type IV pilus minor pilin ComGE	Machinery gene
PW252_RS00710 (PW252_00710)	comGF/cglF	111943..112377 (+)	435	WP_248049590.1	competence type IV pilus minor pilin ComGF	Machinery gene
PW252_RS00715 (PW252_00715)	comGG	112355..112873 (+)	519	WP_248049592.1	competence type IV pilus minor pilin ComGG	-
PW252_RS00720 (PW252_00720)	comYH	112927..113880 (+)	954	WP_248049593.1	class I SAM-dependent methyltransferase	Machinery gene
PW252_RS00725 (PW252_00725)	-	113930..115117 (+)	1188	WP_105125239.1	acetate kinase	-
PW252_RS00730 (PW252_00730)	-	115375..115926 (+)	552	WP_105125238.1	folate family ECF transporter S component	-
PW252_RS00735 (PW252_00735)	-	115980..117236 (+)	1257	WP_248049594.1	bifunctional folylpolyglutamate synthase/dihydrofolate synthase	-

Sequence

Protein

Download Length: 144 a.a. Molecular weight: 16518.88 Da Isoelectric Point: 7.9752

                                >NTDB_id=794720 PW252_RS00710 WP_248049590.1 111943..112377(+) (comGF/cglF) [Streptococcus iners strain 29887]

MLKSKIPAFTLLECLVALVILSGSLLIFEGLSKLLVQEAHYQRNSIQKEWLVFSSQLRSEWDQAELVKVENGKVYVNKGE

QALAFGKSRSDDFRKTNDRGQGYQPMLYQVDSAAISQENQLVRIDFSFKNGEERTFIYAFKEKS

Nucleotide

Download Length: 435 bp

                                >NTDB_id=794720 PW252_RS00710 WP_248049590.1 111943..112377(+) (comGF/cglF) [Streptococcus iners strain 29887]

TTGTTAAAAAGTAAAATTCCTGCTTTTACTCTCTTGGAATGCTTGGTAGCCTTAGTCATCCTATCAGGAAGTCTTCTGAT

CTTTGAAGGCTTGTCAAAACTGCTGGTCCAAGAAGCGCATTATCAAAGAAATAGCATCCAGAAGGAATGGTTGGTCTTCT

CTAGTCAATTGCGGTCGGAGTGGGACCAGGCTGAATTGGTCAAGGTTGAAAATGGCAAGGTCTATGTCAACAAAGGCGAA

CAGGCTTTGGCCTTTGGCAAGTCACGGTCGGATGATTTTCGGAAAACAAATGACAGGGGACAGGGTTACCAGCCCATGCT

CTATCAGGTGGATAGCGCAGCCATTTCCCAAGAAAACCAGCTGGTGCGCATCGACTTTAGCTTTAAAAACGGAGAGGAGC

GGACCTTTATCTATGCTTTTAAAGAAAAAAGTTAA

Domains

Predicted by InterproScan.

Putative Competence protein ComGF (ComGF)

(37-134)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGF/cglF	Streptococcus pneumoniae TIGR4	53.191	97.917	0.521
comGF/cglF	Streptococcus pneumoniae Rx1	53.191	97.917	0.521
comGF/cglF	Streptococcus pneumoniae D39	53.191	97.917	0.521
comGF/cglF	Streptococcus pneumoniae R6	53.191	97.917	0.521
comGF/cglF	Streptococcus mitis NCTC 12261	53.731	93.056	0.5
comYF	Streptococcus mutans UA140	49.306	100	0.493
comYF	Streptococcus mutans UA159	48.611	100	0.486
comGF/cglF	Streptococcus mitis SK321	50.746	93.056	0.472
comGF	Lactococcus lactis subsp. cremoris KW2	46.809	97.917	0.458

Detailed information NTG0794720