Detailed information NTG0794718

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: PW252_RS00695
• Genome accession: NZ_CP118735
• Coordinates: 111022..111303 (+)
• Length: 93 a.a.
• NCBI ID: WP_248049584.1
• Uniprot ID: A0AA97A2V1
• Organism: Streptococcus iners strain 29887
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 106022..116303

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PW252_RS00670 (PW252_00670)	-	106108..106485 (+)	378	WP_172049590.1	DUF1033 family protein	-
PW252_RS00675 (PW252_00675)	-	106605..107948 (-)	1344	Protein_99	IS1182 family transposase	-
PW252_RS00680 (PW252_00680)	-	108086..109036 (-)	951	WP_248049579.1	S66 peptidase family protein	-
PW252_RS00685 (PW252_00685)	comYA	109121..110071 (+)	951	WP_248049581.1	competence type IV pilus ATPase ComGA	Machinery gene
PW252_RS00690 (PW252_00690)	comYB	109983..111020 (+)	1038	WP_248049583.1	competence type IV pilus assembly protein ComGB	Machinery gene
PW252_RS00695 (PW252_00695)	comYC	111022..111303 (+)	282	WP_248049584.1	competence type IV pilus major pilin ComGC	Machinery gene
PW252_RS00700 (PW252_00700)	comGD	111284..111691 (+)	408	WP_248049586.1	competence type IV pilus minor pilin ComGD	-
PW252_RS00705 (PW252_00705)	comYE	111663..111956 (+)	294	WP_248049588.1	competence type IV pilus minor pilin ComGE	Machinery gene
PW252_RS00710 (PW252_00710)	comGF/cglF	111943..112377 (+)	435	WP_248049590.1	competence type IV pilus minor pilin ComGF	Machinery gene
PW252_RS00715 (PW252_00715)	comGG	112355..112873 (+)	519	WP_248049592.1	competence type IV pilus minor pilin ComGG	-
PW252_RS00720 (PW252_00720)	comYH	112927..113880 (+)	954	WP_248049593.1	class I SAM-dependent methyltransferase	Machinery gene
PW252_RS00725 (PW252_00725)	-	113930..115117 (+)	1188	WP_105125239.1	acetate kinase	-
PW252_RS00730 (PW252_00730)	-	115375..115926 (+)	552	WP_105125238.1	folate family ECF transporter S component	-

Sequence

Protein

• Length: 93 a.a.
• Molecular weight: 10391.31 Da
• Isoelectric Point: 8.4369

>NTDB_id=794718 PW252_RS00695 WP_248049584.1 111022..111303(+) (comYC) [Streptococcus iners strain 29887]
MKKLNKMKVKAFTLVEMLVVLGIISLLLLLFVPNLSKQKEAVQEKGNAAVVKVVESQMELYELEHDTEATVAELQAKGYI
TPKQAEQYATAKQ

Nucleotide

• Length: 282 bp

>NTDB_id=794718 PW252_RS00695 WP_248049584.1 111022..111303(+) (comYC) [Streptococcus iners strain 29887]
ATGAAAAAATTGAATAAAATGAAAGTAAAAGCCTTCACTCTGGTGGAAATGTTAGTTGTTTTGGGTATCATTAGCCTACT
CTTGCTCCTCTTTGTACCAAATTTGAGTAAGCAAAAAGAAGCTGTTCAAGAGAAAGGGAATGCGGCGGTCGTCAAGGTTG
TGGAAAGTCAGATGGAGCTCTATGAATTGGAACATGACACGGAAGCAACGGTGGCCGAGTTGCAGGCGAAAGGTTATATT
ACTCCAAAACAAGCGGAGCAGTATGCTACGGCGAAACAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (7-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus suis isolate S10	86.022	100	0.86
comYC	Streptococcus gordonii str. Challis substr. CH1	68.539	95.699	0.656
comGC/cglC	Streptococcus pneumoniae Rx1	70.588	91.398	0.645
comGC/cglC	Streptococcus pneumoniae D39	70.588	91.398	0.645
comGC/cglC	Streptococcus pneumoniae R6	70.588	91.398	0.645
comGC/cglC	Streptococcus mitis NCTC 12261	70.588	91.398	0.645
comGC/cglC	Streptococcus mitis SK321	70.588	91.398	0.645
comGC/cglC	Streptococcus pneumoniae TIGR4	70.588	91.398	0.645
comYC	Streptococcus mutans UA140	62.5	94.624	0.591
comYC	Streptococcus mutans UA159	62.5	94.624	0.591
comGC	Lactococcus lactis subsp. cremoris KW2	60.227	94.624	0.57
comGC	Staphylococcus aureus MW2	50	79.57	0.398
comGC	Staphylococcus aureus N315	50	79.57	0.398
comGC	Bacillus subtilis subsp. subtilis str. 168	45.333	80.645	0.366