Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | PQQ74_RS09960 | Genome accession | NZ_CP117203 |
| Coordinates | 2021487..2021957 (-) | Length | 156 a.a. |
| NCBI ID | WP_000934753.1 | Uniprot ID | A0A1S5YP95 |
| Organism | Staphylococcus aureus strain 2022QW-00133 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1991787..2047736 | 2021487..2021957 | within | 0 |
Gene organization within MGE regions
Location: 1991787..2047736
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ74_RS09740 (PQQ74_09740) | scn | 1991787..1992137 (-) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| PQQ74_RS09745 (PQQ74_09745) | - | 1992822..1993271 (+) | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| PQQ74_RS09750 (PQQ74_09750) | - | 1993366..1993701 (-) | 336 | Protein_1881 | SH3 domain-containing protein | - |
| PQQ74_RS09755 (PQQ74_09755) | sak | 1994351..1994842 (-) | 492 | WP_000919350.1 | staphylokinase | - |
| PQQ74_RS09760 (PQQ74_09760) | - | 1995033..1995788 (-) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| PQQ74_RS09765 (PQQ74_09765) | - | 1995800..1996054 (-) | 255 | WP_000611512.1 | phage holin | - |
| PQQ74_RS09770 (PQQ74_09770) | - | 1996106..1996213 (+) | 108 | WP_001791821.1 | hypothetical protein | - |
| PQQ74_RS09775 (PQQ74_09775) | pepG1 | 1996266..1996400 (-) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| PQQ74_RS09780 (PQQ74_09780) | - | 1996592..1996888 (-) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| PQQ74_RS09785 (PQQ74_09785) | - | 1996946..1997233 (-) | 288 | WP_001040261.1 | hypothetical protein | - |
| PQQ74_RS09790 (PQQ74_09790) | - | 1997280..1997432 (-) | 153 | WP_001153681.1 | hypothetical protein | - |
| PQQ74_RS09795 (PQQ74_09795) | - | 1997422..2001207 (-) | 3786 | WP_273655515.1 | phage tail spike protein | - |
| PQQ74_RS09800 (PQQ74_09800) | - | 2001223..2002707 (-) | 1485 | WP_000567394.1 | phage tail domain-containing protein | - |
| PQQ74_RS09805 (PQQ74_09805) | - | 2002704..2007233 (-) | 4530 | WP_001551779.1 | phage tail tape measure protein | - |
| PQQ74_RS09810 (PQQ74_09810) | - | 2007290..2007427 (-) | 138 | WP_001549167.1 | hypothetical protein | - |
| PQQ74_RS09815 (PQQ74_09815) | - | 2007478..2007828 (-) | 351 | WP_001096354.1 | hypothetical protein | - |
| PQQ74_RS09820 (PQQ74_09820) | - | 2007878..2008117 (-) | 240 | WP_094969769.1 | Ig-like domain-containing protein | - |
| PQQ74_RS09825 (PQQ74_09825) | - | 2008144..2008788 (-) | 645 | WP_000260578.1 | major tail protein | - |
| PQQ74_RS09830 (PQQ74_09830) | - | 2008792..2009196 (-) | 405 | WP_000565500.1 | hypothetical protein | - |
| PQQ74_RS09835 (PQQ74_09835) | - | 2009193..2009597 (-) | 405 | WP_000114229.1 | HK97 gp10 family phage protein | - |
| PQQ74_RS09840 (PQQ74_09840) | - | 2009594..2009956 (-) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| PQQ74_RS09845 (PQQ74_09845) | - | 2009940..2010224 (-) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| PQQ74_RS09850 (PQQ74_09850) | - | 2010214..2010498 (-) | 285 | WP_000238236.1 | hypothetical protein | - |
| PQQ74_RS09855 (PQQ74_09855) | - | 2010518..2011663 (-) | 1146 | WP_000154559.1 | phage major capsid protein | - |
| PQQ74_RS09860 (PQQ74_09860) | - | 2011687..2012424 (-) | 738 | WP_000642728.1 | head maturation protease, ClpP-related | - |
| PQQ74_RS09865 (PQQ74_09865) | - | 2012408..2013595 (-) | 1188 | WP_000025274.1 | phage portal protein | - |
| PQQ74_RS09870 (PQQ74_09870) | - | 2013611..2015272 (-) | 1662 | WP_000625088.1 | terminase large subunit | - |
| PQQ74_RS09875 (PQQ74_09875) | - | 2015269..2015613 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| PQQ74_RS09880 (PQQ74_09880) | - | 2015743..2016042 (-) | 300 | WP_000988336.1 | HNH endonuclease | - |
| PQQ74_RS09885 (PQQ74_09885) | - | 2016274..2016690 (-) | 417 | WP_000590122.1 | hypothetical protein | - |
| PQQ74_RS09890 (PQQ74_09890) | - | 2016718..2016918 (-) | 201 | WP_000265043.1 | DUF1514 family protein | - |
| PQQ74_RS09895 (PQQ74_09895) | - | 2016918..2017067 (-) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| PQQ74_RS09900 (PQQ74_09900) | - | 2017064..2017450 (-) | 387 | WP_000592207.1 | hypothetical protein | - |
| PQQ74_RS09905 (PQQ74_09905) | - | 2017447..2017653 (-) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| PQQ74_RS09910 (PQQ74_09910) | - | 2017650..2017895 (-) | 246 | WP_001282074.1 | hypothetical protein | - |
| PQQ74_RS09915 (PQQ74_09915) | - | 2017932..2018465 (-) | 534 | WP_000181819.1 | dUTP pyrophosphatase | - |
| PQQ74_RS09920 (PQQ74_09920) | - | 2018458..2018700 (-) | 243 | WP_000700108.1 | hypothetical protein | - |
| PQQ74_RS09925 (PQQ74_09925) | - | 2018690..2018926 (-) | 237 | WP_001065103.1 | DUF1024 family protein | - |
| PQQ74_RS09930 (PQQ74_09930) | - | 2018919..2019290 (-) | 372 | WP_001549172.1 | hypothetical protein | - |
| PQQ74_RS09935 (PQQ74_09935) | - | 2019299..2019541 (-) | 243 | WP_000131383.1 | phi PVL orf 51-like protein | - |
| PQQ74_RS09940 (PQQ74_09940) | - | 2019545..2019913 (-) | 369 | WP_000101288.1 | SA1788 family PVL leukocidin-associated protein | - |
| PQQ74_RS09945 (PQQ74_09945) | - | 2019926..2020330 (-) | 405 | WP_000401977.1 | RusA family crossover junction endodeoxyribonuclease | - |
| PQQ74_RS09950 (PQQ74_09950) | - | 2020339..2020557 (-) | 219 | WP_000338530.1 | hypothetical protein | - |
| PQQ74_RS09955 (PQQ74_09955) | - | 2020564..2021457 (-) | 894 | WP_000148333.1 | DnaD domain-containing protein | - |
| PQQ74_RS09960 (PQQ74_09960) | ssbA | 2021487..2021957 (-) | 471 | WP_000934753.1 | single-stranded DNA-binding protein | Machinery gene |
| PQQ74_RS09965 (PQQ74_09965) | - | 2021958..2022575 (-) | 618 | WP_071665632.1 | MBL fold metallo-hydrolase | - |
| PQQ74_RS09970 (PQQ74_09970) | - | 2022656..2023576 (-) | 921 | WP_000138475.1 | recombinase RecT | - |
| PQQ74_RS09975 (PQQ74_09975) | - | 2023578..2025521 (-) | 1944 | WP_000700561.1 | AAA family ATPase | - |
| PQQ74_RS09980 (PQQ74_09980) | - | 2025530..2025793 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| PQQ74_RS09985 (PQQ74_09985) | - | 2025802..2026062 (-) | 261 | WP_000291513.1 | DUF1108 family protein | - |
| PQQ74_RS09990 (PQQ74_09990) | - | 2026043..2026362 (-) | 320 | Protein_1929 | DUF2482 family protein | - |
| PQQ74_RS09995 (PQQ74_09995) | - | 2026457..2026618 (-) | 162 | WP_001285960.1 | DUF1270 domain-containing protein | - |
| PQQ74_RS10000 (PQQ74_10000) | - | 2026615..2026935 (-) | 321 | WP_001120199.1 | DUF771 domain-containing protein | - |
| PQQ74_RS10005 (PQQ74_10005) | - | 2026994..2027224 (+) | 231 | WP_000549548.1 | hypothetical protein | - |
| PQQ74_RS10010 (PQQ74_10010) | - | 2027221..2027397 (-) | 177 | WP_001001356.1 | hypothetical protein | - |
| PQQ74_RS10015 (PQQ74_10015) | - | 2027413..2028165 (-) | 753 | WP_001148642.1 | phage antirepressor KilAC domain-containing protein | - |
| PQQ74_RS10020 (PQQ74_10020) | - | 2028216..2028545 (+) | 330 | WP_000180411.1 | hypothetical protein | - |
| PQQ74_RS10025 (PQQ74_10025) | - | 2028534..2028749 (-) | 216 | WP_001025404.1 | MW1434 family type I TA system toxin | - |
| PQQ74_RS10030 (PQQ74_10030) | - | 2028765..2029028 (-) | 264 | WP_000854072.1 | helix-turn-helix transcriptional regulator | - |
| PQQ74_RS10035 (PQQ74_10035) | - | 2029025..2029198 (-) | 174 | WP_001801500.1 | hypothetical protein | - |
| PQQ74_RS10040 (PQQ74_10040) | - | 2029161..2029874 (+) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| PQQ74_RS10045 (PQQ74_10045) | - | 2029890..2030822 (+) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| PQQ74_RS10050 (PQQ74_10050) | - | 2030828..2031169 (+) | 342 | WP_000591749.1 | hypothetical protein | - |
| PQQ74_RS10055 (PQQ74_10055) | - | 2031373..2031555 (+) | 183 | WP_000705246.1 | hypothetical protein | - |
| PQQ74_RS10060 (PQQ74_10060) | - | 2031633..2032346 (+) | 714 | WP_001549185.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| PQQ74_RS10065 (PQQ74_10065) | - | 2032537..2033574 (+) | 1038 | WP_000857199.1 | site-specific integrase | - |
| PQQ74_RS10070 (PQQ74_10070) | sph | 2033625..2034455 (+) | 831 | Protein_1945 | sphingomyelin phosphodiesterase | - |
| PQQ74_RS10075 (PQQ74_10075) | lukG | 2034693..2035709 (-) | 1017 | WP_000595324.1 | bi-component leukocidin LukGH subunit G | - |
| PQQ74_RS10080 (PQQ74_10080) | lukH | 2035731..2036786 (-) | 1056 | WP_000791407.1 | bi-component leukocidin LukGH subunit H | - |
| PQQ74_RS10085 (PQQ74_10085) | - | 2037221..2038444 (+) | 1224 | WP_000206639.1 | ArgE/DapE family deacylase | - |
| PQQ74_RS10090 (PQQ74_10090) | - | 2038816..2039661 (-) | 846 | WP_000812010.1 | class I SAM-dependent methyltransferase | - |
| PQQ74_RS10095 (PQQ74_10095) | - | 2039723..2040634 (-) | 912 | WP_000825510.1 | iron-hydroxamate ABC transporter substrate-binding protein | - |
| PQQ74_RS10100 (PQQ74_10100) | - | 2040795..2042102 (+) | 1308 | WP_001045079.1 | TrkH family potassium uptake protein | - |
| PQQ74_RS10105 (PQQ74_10105) | - | 2042955..2043398 (-) | 444 | WP_000022887.1 | GNAT family N-acetyltransferase | - |
| PQQ74_RS10110 (PQQ74_10110) | - | 2043504..2043940 (-) | 437 | Protein_1953 | hypothetical protein | - |
| PQQ74_RS10115 (PQQ74_10115) | - | 2044259..2044849 (-) | 591 | WP_001293058.1 | terminase small subunit | - |
| PQQ74_RS10120 (PQQ74_10120) | - | 2044846..2045058 (-) | 213 | WP_000128898.1 | hypothetical protein | - |
| PQQ74_RS10125 (PQQ74_10125) | - | 2045119..2045665 (+) | 547 | Protein_1956 | site-specific integrase | - |
| PQQ74_RS10130 (PQQ74_10130) | groL | 2045760..2047376 (-) | 1617 | WP_000240645.1 | chaperonin GroEL | - |
| PQQ74_RS10135 (PQQ74_10135) | groES | 2047452..2047736 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17668.55 Da Isoelectric Point: 5.2672
>NTDB_id=782864 PQQ74_RS09960 WP_000934753.1 2021487..2021957(-) (ssbA) [Staphylococcus aureus strain 2022QW-00133]
MLNRTILVGRLTRDPELRTTQNGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MLNRTILVGRLTRDPELRTTQNGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=782864 PQQ74_RS09960 WP_000934753.1 2021487..2021957(-) (ssbA) [Staphylococcus aureus strain 2022QW-00133]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAATGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAATGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
56.497 |
100 |
0.641 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50 |
100 |
0.545 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
33.333 |
100 |
0.378 |
| ssb | Neisseria meningitidis MC58 |
33.526 |
100 |
0.372 |
| ssb | Neisseria gonorrhoeae MS11 |
33.526 |
100 |
0.372 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
47.5 |
76.923 |
0.365 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
47.5 |
76.923 |
0.365 |