Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   OS084_RS01145 Genome accession   NZ_CP113052
Coordinates   179058..179528 (-) Length   156 a.a.
NCBI ID   WP_000934753.1    Uniprot ID   A0A1S5YP95
Organism   Staphylococcus aureus strain Fizz     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 149358..205306 179058..179528 within 0


Gene organization within MGE regions


Location: 149358..205306
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OS084_RS00925 scn 149358..149708 (-) 351 WP_000702263.1 complement inhibitor SCIN-A -
  OS084_RS00930 - 150393..150842 (+) 450 WP_000727649.1 chemotaxis-inhibiting protein CHIPS -
  OS084_RS00935 - 150937..151275 (-) 339 Protein_150 SH3 domain-containing protein -
  OS084_RS00940 sak 151922..152413 (-) 492 WP_000919350.1 staphylokinase -
  OS084_RS00945 - 152604..153359 (-) 756 WP_031785843.1 CHAP domain-containing protein -
  OS084_RS00950 - 153371..153625 (-) 255 WP_000611512.1 phage holin -
  OS084_RS00955 - 153677..153784 (+) 108 WP_001791821.1 hypothetical protein -
  OS084_RS00960 pepG1 153837..153971 (-) 135 WP_000226108.1 type I toxin-antitoxin system toxin PepG1 -
  OS084_RS00965 - 154163..154459 (-) 297 WP_000539688.1 DUF2951 domain-containing protein -
  OS084_RS00970 - 154517..154804 (-) 288 WP_001040261.1 hypothetical protein -
  OS084_RS00975 - 154851..155003 (-) 153 WP_001153681.1 hypothetical protein -
  OS084_RS00980 - 154993..158778 (-) 3786 WP_000582165.1 phage tail spike protein -
  OS084_RS00985 - 158794..160278 (-) 1485 WP_000567394.1 phage distal tail protein -
  OS084_RS00990 - 160275..164804 (-) 4530 WP_001549166.1 phage tail tape measure protein -
  OS084_RS00995 gpGT 164861..164998 (-) 138 WP_001549167.1 phage tail assembly chaperone GT -
  OS084_RS01000 gpG 165049..165399 (-) 351 WP_001096354.1 phage tail assembly chaperone G -
  OS084_RS01005 - 165449..165688 (-) 240 WP_094969769.1 Ig-like domain-containing protein -
  OS084_RS01010 - 165715..166359 (-) 645 WP_000260578.1 major tail protein -
  OS084_RS01015 - 166363..166767 (-) 405 WP_000565500.1 hypothetical protein -
  OS084_RS01020 - 166764..167168 (-) 405 WP_000114229.1 HK97 gp10 family phage protein -
  OS084_RS01025 - 167165..167527 (-) 363 WP_000755150.1 head-tail adaptor protein -
  OS084_RS01030 - 167511..167795 (-) 285 WP_000150936.1 phage head-tail adapter protein -
  OS084_RS01035 - 167785..168069 (-) 285 WP_000238236.1 hypothetical protein -
  OS084_RS01040 - 168089..169234 (-) 1146 WP_000154559.1 phage major capsid protein -
  OS084_RS01045 - 169258..169995 (-) 738 WP_000642728.1 head maturation protease, ClpP-related -
  OS084_RS01050 - 169979..171166 (-) 1188 WP_000025274.1 phage portal protein -
  OS084_RS01055 - 171182..172843 (-) 1662 WP_000625088.1 terminase large subunit -
  OS084_RS01060 - 172840..173184 (-) 345 WP_000402904.1 hypothetical protein -
  OS084_RS01065 - 173314..173613 (-) 300 WP_000988336.1 HNH endonuclease -
  OS084_RS01070 - 173845..174261 (-) 417 WP_000590122.1 hypothetical protein -
  OS084_RS01075 - 174289..174489 (-) 201 WP_000265043.1 DUF1514 family protein -
  OS084_RS01080 rinB 174489..174638 (-) 150 WP_000595265.1 transcriptional activator RinB -
  OS084_RS01085 - 174635..175021 (-) 387 WP_000592207.1 hypothetical protein -
  OS084_RS01090 - 175018..175224 (-) 207 WP_000195803.1 DUF1381 domain-containing protein -
  OS084_RS01095 - 175221..175466 (-) 246 WP_001282074.1 hypothetical protein -
  OS084_RS01100 - 175503..176036 (-) 534 WP_000181819.1 dUTP diphosphatase -
  OS084_RS01105 - 176029..176271 (-) 243 WP_000700108.1 hypothetical protein -
  OS084_RS01110 - 176261..176497 (-) 237 WP_001065101.1 DUF1024 family protein -
  OS084_RS01115 - 176490..176861 (-) 372 WP_001549172.1 hypothetical protein -
  OS084_RS01120 - 176870..177112 (-) 243 WP_000131383.1 phi PVL orf 51-like protein -
  OS084_RS01125 - 177116..177484 (-) 369 WP_000101288.1 SA1788 family PVL leukocidin-associated protein -
  OS084_RS01130 - 177497..177901 (-) 405 WP_000401977.1 RusA family crossover junction endodeoxyribonuclease -
  OS084_RS01135 - 177910..178128 (-) 219 WP_000338530.1 hypothetical protein -
  OS084_RS01140 - 178135..179028 (-) 894 WP_000148333.1 DnaD domain protein -
  OS084_RS01145 ssbA 179058..179528 (-) 471 WP_000934753.1 single-stranded DNA-binding protein Machinery gene
  OS084_RS01150 - 179529..180146 (-) 618 WP_071665632.1 MBL fold metallo-hydrolase -
  OS084_RS01155 - 180227..181147 (-) 921 WP_267838004.1 recombinase RecT -
  OS084_RS01160 - 181149..183092 (-) 1944 WP_000700561.1 AAA family ATPase -
  OS084_RS01165 - 183101..183364 (-) 264 WP_001205732.1 hypothetical protein -
  OS084_RS01170 - 183373..183633 (-) 261 WP_000291513.1 DUF1108 family protein -
  OS084_RS01175 - 183673..183933 (-) 261 WP_001549178.1 DUF2482 family protein -
  OS084_RS01180 - 184028..184189 (-) 162 WP_001285960.1 DUF1270 domain-containing protein -
  OS084_RS01185 - 184186..184506 (-) 321 WP_001120199.1 DUF771 domain-containing protein -
  OS084_RS01190 - 184565..184795 (+) 231 WP_000549548.1 hypothetical protein -
  OS084_RS01195 - 184792..184968 (-) 177 WP_001001356.1 hypothetical protein -
  OS084_RS01200 - 184984..185736 (-) 753 WP_001148642.1 phage antirepressor KilAC domain-containing protein -
  OS084_RS01205 - 185787..186116 (+) 330 WP_000180411.1 hypothetical protein -
  OS084_RS01210 - 186105..186320 (-) 216 WP_001025404.1 Thoeris anti-defense Tad2 family protein -
  OS084_RS01215 - 186336..186599 (-) 264 WP_000854072.1 helix-turn-helix transcriptional regulator -
  OS084_RS01220 - 186596..186769 (-) 174 WP_001801500.1 hypothetical protein -
  OS084_RS01225 - 186732..187445 (+) 714 WP_001031454.1 XRE family transcriptional regulator -
  OS084_RS01230 - 187461..188393 (+) 933 WP_000759682.1 exonuclease domain-containing protein -
  OS084_RS01235 - 188399..188740 (+) 342 WP_000591749.1 hypothetical protein -
  OS084_RS01240 - 188944..189126 (+) 183 WP_000705246.1 hypothetical protein -
  OS084_RS01245 - 189204..189917 (+) 714 WP_001549185.1 type II toxin-antitoxin system PemK/MazF family toxin -
  OS084_RS01250 - 190108..191145 (+) 1038 WP_000857199.1 tyrosine-type recombinase/integrase -
  OS084_RS01255 sph 191202..192026 (+) 825 Protein_214 sphingomyelin phosphodiesterase -
  OS084_RS01260 lukG 192264..193280 (-) 1017 WP_000595324.1 bi-component leukocidin LukGH subunit G -
  OS084_RS01265 lukH 193302..194357 (-) 1056 WP_000791407.1 bi-component leukocidin LukGH subunit H -
  OS084_RS01270 - 194792..196015 (+) 1224 WP_000206639.1 ArgE/DapE family deacylase -
  OS084_RS01275 - 196387..197232 (-) 846 WP_000812010.1 class I SAM-dependent methyltransferase -
  OS084_RS01280 - 197294..198205 (-) 912 WP_000825510.1 iron-hydroxamate ABC transporter substrate-binding protein -
  OS084_RS01285 - 198366..199673 (+) 1308 WP_001045079.1 TrkH family potassium uptake protein -
  OS084_RS01290 - 200526..200969 (-) 444 WP_000022887.1 GNAT family N-acetyltransferase -
  OS084_RS01295 - 201075..201511 (-) 437 Protein_222 hypothetical protein -
  OS084_RS01300 - 201829..202419 (-) 591 WP_001293058.1 terminase small subunit -
  OS084_RS01305 - 202416..202628 (-) 213 WP_000128898.1 LuxR C-terminal-related transcriptional regulator -
  OS084_RS01310 - 202689..203235 (+) 547 Protein_225 site-specific integrase -
  OS084_RS01315 groL 203330..204946 (-) 1617 WP_000240645.1 chaperonin GroEL -
  OS084_RS01320 groES 205022..205306 (-) 285 WP_000917289.1 co-chaperone GroES -

Sequence

Protein


Download         Length: 156 a.a.        Molecular weight: 17668.55 Da        Isoelectric Point: 5.2672

>NTDB_id=759611 OS084_RS01145 WP_000934753.1 179058..179528(-) (ssbA) [Staphylococcus aureus strain Fizz]
MLNRTILVGRLTRDPELRTTQNGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=759611 OS084_RS01145 WP_000934753.1 179058..179528(-) (ssbA) [Staphylococcus aureus strain Fizz]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAATGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A1S5YP95

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

56.497

100

0.641
  ssb Latilactobacillus sakei subsp. sakei 23K

50

100

0.545
  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404
  ssb Glaesserella parasuis strain SC1401

33.333

100

0.378
  ssb Neisseria meningitidis MC58

33.526

100

0.372
  ssb Neisseria gonorrhoeae MS11

33.526

100

0.372
  ssbB/cilA Streptococcus pneumoniae TIGR4

47.5

76.923

0.365
  ssbB/cilA Streptococcus mitis NCTC 12261

47.5

76.923

0.365