Detailed information NTG0736620

Bioinformatically predicted

Overview

• Name: pilC
• Type: Machinery gene
• Locus tag: ND436_RS12500
• Genome accession: NZ_CP106918
• Coordinates: 55467..55595 (-)
• Length: 42 a.a.
• NCBI ID: WP_322740851.1
• Uniprot ID: -
• Organism: Neisseria gonorrhoeae strain 9071
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 50467..60595

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ND436_RS00265 (ND436_000265)	pilC	52447..55467 (-)	3021	WP_322740850.1	PilC family type IV pilus tip adhesin	Machinery gene
ND436_RS12500	pilC	55467..55595 (-)	129	WP_322740851.1	hypothetical protein	Machinery gene
ND436_RS00270 (ND436_000270)	apbC	57317..58396 (-)	1080	WP_003699443.1	iron-sulfur cluster carrier protein ApbC	-
ND436_RS00280 (ND436_000280)	-	58770..59279 (+)	510	WP_003687293.1	protein disulfide oxidoreductase	-
ND436_RS00285 (ND436_000285)	nadR	59620..60060 (+)	441	WP_003687296.1	MarR family adhesin repressor NadR	-

Sequence

Protein

• Length: 42 a.a.
• Molecular weight: 4929.91 Da
• Isoelectric Point: 13.0490

>NTDB_id=736620 ND436_RS12500 WP_322740851.1 55467..55595(-) (pilC) [Neisseria gonorrhoeae strain 9071]
MNKTLKRRVFRHTALYAAILMFSHTGGRGGGRRRRKRMNTLL

Nucleotide

• Length: 129 bp

>NTDB_id=736620 ND436_RS12500 WP_322740851.1 55467..55595(-) (pilC) [Neisseria gonorrhoeae strain 9071]
ATGAATAAAACTTTAAAAAGGCGGGTTTTCCGCCATACCGCGCTTTATGCCGCCATCTTGATGTTTTCCCATACCGGCGG
GCGGGGGGGGGGCAGGCGCAGGCGCAAACGTATGAATACGCTATTGTGA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilC	Neisseria meningitidis A1493	77.778	85.714	0.667