Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   P8191_RS06895 Genome accession   NZ_CP121250
Coordinates   1330292..1330576 (-) Length   94 a.a.
NCBI ID   WP_002987779.1    Uniprot ID   A0A0H2USY2
Organism   Streptococcus pyogenes strain 1044     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1325292..1335576
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P8191_RS06865 (P8191_06865) proC 1325901..1326671 (+) 771 WP_010921805.1 pyrroline-5-carboxylate reductase -
  P8191_RS06870 (P8191_06870) - 1326754..1327062 (-) 309 WP_010921804.1 hypothetical protein -
  P8191_RS06875 (P8191_06875) - 1327249..1328445 (-) 1197 WP_010921803.1 acetate kinase -
  P8191_RS06880 (P8191_06880) comGH 1328504..1329457 (-) 954 WP_010921802.1 class I SAM-dependent methyltransferase Machinery gene
  P8191_RS06885 (P8191_06885) comGG 1329555..1329881 (-) 327 WP_010921801.1 competence type IV pilus minor pilin ComGG -
  P8191_RS06890 (P8191_06890) comGF 1329865..1330299 (-) 435 WP_010921800.1 competence type IV pilus minor pilin ComGF Machinery gene
  P8191_RS06895 (P8191_06895) comGE 1330292..1330576 (-) 285 WP_002987779.1 competence type IV pilus minor pilin ComGE Machinery gene
  P8191_RS06900 (P8191_06900) comGD 1330533..1330961 (-) 429 WP_002986548.1 competence type IV pilus minor pilin ComGD Machinery gene
  P8191_RS06905 (P8191_06905) comGC 1330936..1331262 (-) 327 WP_002986552.1 competence type IV pilus major pilin ComGC Machinery gene
  P8191_RS06910 (P8191_06910) comGB 1331264..1332298 (-) 1035 WP_011054115.1 competence type IV pilus assembly protein ComGB Machinery gene
  P8191_RS06915 (P8191_06915) comGA 1332234..1333172 (-) 939 WP_010921798.1 competence type IV pilus ATPase ComGA Machinery gene
  P8191_RS06920 (P8191_06920) - 1333265..1333630 (-) 366 WP_002986560.1 DUF1033 family protein -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10672.62 Da        Isoelectric Point: 8.9043

>NTDB_id=736617 P8191_RS06895 WP_002987779.1 1330292..1330576(-) (comGE) [Streptococcus pyogenes strain 1044]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEMTLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=736617 P8191_RS06895 WP_002987779.1 1330292..1330576(-) (comGE) [Streptococcus pyogenes strain 1044]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATCGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATGACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A0H2USY2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383