Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | C11O2_RS05985 | Genome accession | NZ_AP019548 |
| Coordinates | 1169309..1169491 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain 10-85 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1145312..1203521 | 1169309..1169491 | within | 0 |
Gene organization within MGE regions
Location: 1145312..1203521
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C11O2_RS05875 (A85_10830) | - | 1145312..1146424 (-) | 1113 | WP_001842570.1 | recombinase family protein | - |
| C11O2_RS05880 (A85_10840) | - | 1146553..1147188 (-) | 636 | WP_000207454.1 | CpXC domain-containing protein | - |
| C11O2_RS05885 (A85_10850) | - | 1147320..1148999 (-) | 1680 | Protein_1088 | ComEC/Rec2 family competence protein | - |
| C11O2_RS05890 (A85_10860) | - | 1148980..1149642 (-) | 663 | WP_002983967.1 | ComEA family DNA-binding protein | - |
| C11O2_RS05895 (A85_10870) | - | 1149842..1150582 (-) | 741 | WP_011285604.1 | lysophospholipid acyltransferase family protein | - |
| C11O2_RS05900 (A85_10880) | - | 1150700..1151476 (+) | 777 | WP_010922438.1 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | - |
| C11O2_RS05905 (A85_10890) | - | 1151466..1151744 (+) | 279 | WP_002989164.1 | GIY-YIG nuclease family protein | - |
| C11O2_RS05910 (A85_10900) | - | 1151768..1153768 (-) | 2001 | WP_010922439.1 | potassium transporter Kup | - |
| C11O2_RS05915 (A85_10910) | - | 1153896..1155515 (-) | 1620 | WP_002989158.1 | DEAD/DEAH box helicase | - |
| C11O2_RS05920 (A85_10920) | - | 1155822..1157366 (-) | 1545 | WP_002989155.1 | peptide chain release factor 3 | - |
| C11O2_RS05930 (A85_10930) | - | 1157614..1158309 (-) | 696 | WP_011285607.1 | TIGR02206 family membrane protein | - |
| C11O2_RS05935 (A85_10940) | - | 1158389..1159780 (-) | 1392 | WP_010922441.1 | UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase | - |
| C11O2_RS05940 (A85_10950) | - | 1159971..1161017 (-) | 1047 | WP_002989146.1 | D-alanine--D-alanine ligase | - |
| C11O2_RS05945 (A85_10960) | recR | 1161118..1161714 (-) | 597 | WP_002983939.1 | recombination mediator RecR | - |
| C11O2_RS09300 (A85_10970) | - | 1161761..1161952 (-) | 192 | WP_011285608.1 | hypothetical protein | - |
| C11O2_RS05955 (A85_10980) | - | 1162513..1163292 (-) | 780 | WP_002989141.1 | formate/nitrite transporter family protein | - |
| C11O2_RS05960 (A85_10990) | - | 1163416..1163958 (-) | 543 | WP_002989140.1 | hypothetical protein | - |
| C11O2_RS05965 (A85_11000) | - | 1164119..1164640 (-) | 522 | WP_002983930.1 | transcription repressor NadR | - |
| C11O2_RS05970 (A85_11010) | - | 1164747..1165442 (-) | 696 | WP_002983928.1 | phosphoglycerate mutase | - |
| C11O2_RS05975 (A85_11020) | - | 1165681..1166616 (+) | 936 | WP_010922443.1 | dihydroorotate oxidase | - |
| C11O2_RS05980 (A85_11040) | - | 1166916..1168778 (-) | 1863 | WP_011285610.1 | heavy metal translocating P-type ATPase | - |
| C11O2_RS05985 (A85_11050) | prx | 1169309..1169491 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| C11O2_RS05990 (A85_11060) | sda3 | 1169730..1170530 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| C11O2_RS05995 (A85_11070) | - | 1170801..1171235 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| C11O2_RS06000 (A85_11080) | - | 1171305..1172510 (-) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| C11O2_RS06005 (A85_11090) | - | 1172626..1172853 (-) | 228 | WP_003058873.1 | phage holin | - |
| C11O2_RS06010 (A85_11100) | - | 1172850..1173125 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| C11O2_RS06015 (A85_11110) | - | 1173135..1173431 (-) | 297 | Protein_1113 | hypothetical protein | - |
| C11O2_RS06020 (A85_11120) | - | 1173422..1173784 (-) | 363 | Protein_1114 | phage tail protein | - |
| C11O2_RS06025 (A85_11130) | - | 1173777..1174241 (-) | 465 | WP_142235930.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| C11O2_RS06030 (A85_11140) | - | 1174322..1175365 (-) | 1044 | Protein_1116 | terminase | - |
| C11O2_RS06035 (A85_11150) | - | 1175368..1175622 (-) | 255 | Protein_1117 | hypothetical protein | - |
| C11O2_RS06040 (A85_11160) | - | 1175619..1175975 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| C11O2_RS06045 (A85_11170) | - | 1176124..1176468 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| C11O2_RS06050 (A85_11180) | - | 1176577..1176996 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| C11O2_RS06055 (A85_11190) | - | 1177264..1177899 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| C11O2_RS06060 | - | 1177901..1178110 (-) | 210 | WP_415245494.1 | hypothetical protein | - |
| C11O2_RS09205 | - | 1178093..1178314 (-) | 222 | Protein_1123 | transcriptional regulator | - |
| C11O2_RS06065 (A85_11210) | - | 1178414..1178599 (-) | 186 | WP_011285628.1 | hypothetical protein | - |
| C11O2_RS06070 (A85_11220) | - | 1178601..1178912 (-) | 312 | WP_002990080.1 | hypothetical protein | - |
| C11O2_RS06075 (A85_11230) | - | 1178990..1179175 (-) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| C11O2_RS06080 (A85_11240) | - | 1179342..1179581 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| C11O2_RS06085 (A85_11250) | - | 1179723..1180529 (+) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| C11O2_RS06090 (A85_11260) | - | 1180464..1180730 (-) | 267 | WP_010922204.1 | hypothetical protein | - |
| C11O2_RS06095 (A85_11270) | - | 1180762..1181478 (-) | 717 | WP_011285630.1 | phage antirepressor KilAC domain-containing protein | - |
| C11O2_RS06100 (A85_11280) | - | 1181490..1181681 (-) | 192 | WP_002993390.1 | hypothetical protein | - |
| C11O2_RS06105 | - | 1182317..1182412 (+) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| C11O2_RS06110 (A85_11290) | - | 1182835..1183182 (+) | 348 | WP_011285631.1 | helix-turn-helix domain-containing protein | - |
| C11O2_RS06115 (A85_11300) | - | 1183186..1183566 (+) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| C11O2_RS06120 (A85_11310) | - | 1183578..1183844 (+) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| C11O2_RS06125 (A85_11320) | - | 1183968..1185110 (+) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| C11O2_RS06130 (A85_11330) | - | 1185200..1185475 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| C11O2_RS06135 (A85_11340) | - | 1185574..1186161 (-) | 588 | WP_010922482.1 | YpmS family protein | - |
| C11O2_RS06140 (A85_11350) | - | 1186139..1186981 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
| C11O2_RS06145 (A85_11360) | - | 1186974..1187813 (-) | 840 | WP_002989125.1 | DegV family protein | - |
| C11O2_RS06150 (A85_11370) | - | 1188041..1188982 (-) | 942 | WP_011285633.1 | LPXTG cell wall anchor domain-containing protein | - |
| C11O2_RS06155 (A85_11380) | recN | 1189154..1190815 (-) | 1662 | WP_010922485.1 | DNA repair protein RecN | - |
| C11O2_RS06160 (A85_11390) | - | 1190837..1191307 (-) | 471 | WP_002983907.1 | arginine repressor | - |
| C11O2_RS06165 (A85_11400) | - | 1191294..1192121 (-) | 828 | WP_003056952.1 | TlyA family rRNA (cytidine-2'-O)-methyltransferase | - |
| C11O2_RS06170 (A85_11410) | - | 1192114..1192986 (-) | 873 | WP_003056941.1 | polyprenyl synthetase family protein | - |
| C11O2_RS06175 (A85_11420) | - | 1192986..1193201 (-) | 216 | WP_002983901.1 | exodeoxyribonuclease VII small subunit | - |
| C11O2_RS06180 (A85_11430) | xseA | 1193179..1194519 (-) | 1341 | WP_002992349.1 | exodeoxyribonuclease VII large subunit | - |
| C11O2_RS06185 (A85_11440) | - | 1194672..1195526 (-) | 855 | WP_010922486.1 | bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase | - |
| C11O2_RS06190 (A85_11450) | - | 1195734..1197428 (-) | 1695 | WP_002989112.1 | phospho-sugar mutase | - |
| C11O2_RS06195 (A85_11460) | - | 1197606..1199015 (-) | 1410 | WP_010922487.1 | cryptochrome/photolyase family protein | - |
| C11O2_RS06200 (A85_11470) | - | 1199164..1199898 (-) | 735 | WP_010922488.1 | amino acid ABC transporter ATP-binding protein | - |
| C11O2_RS06205 (A85_11480) | - | 1199898..1200584 (-) | 687 | WP_002983887.1 | amino acid ABC transporter permease | - |
| C11O2_RS06210 (A85_11490) | - | 1200711..1200941 (-) | 231 | WP_002983885.1 | YkuJ family protein | - |
| C11O2_RS06215 (A85_11500) | clpE | 1201239..1203521 (+) | 2283 | WP_010922489.1 | ATP-dependent Clp protease ATP-binding subunit | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=72886 C11O2_RS05985 WP_011017964.1 1169309..1169491(-) (prx) [Streptococcus pyogenes strain 10-85]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=72886 C11O2_RS05985 WP_011017964.1 1169309..1169491(-) (prx) [Streptococcus pyogenes strain 10-85]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |