Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | N0J69_RS14385 | Genome accession | NZ_CP104020 |
| Coordinates | 2872588..2873058 (+) | Length | 156 a.a. |
| NCBI ID | WP_000934753.1 | Uniprot ID | A0A1S5YP95 |
| Organism | Staphylococcus aureus strain 0831 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2846810..2878802 | 2872588..2873058 | within | 0 |
Gene organization within MGE regions
Location: 2846810..2878802
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N0J69_RS14210 | groES | 2846810..2847094 (+) | 285 | WP_000917289.1 | co-chaperone GroES | - |
| N0J69_RS14215 | groL | 2847170..2848786 (+) | 1617 | WP_000240645.1 | chaperonin GroEL | - |
| N0J69_RS14220 | - | 2848881..2849427 (-) | 547 | Protein_2760 | site-specific integrase | - |
| N0J69_RS14225 | - | 2849488..2849700 (+) | 213 | WP_000128898.1 | LuxR C-terminal-related transcriptional regulator | - |
| N0J69_RS14230 | - | 2849697..2850287 (+) | 591 | WP_001293058.1 | terminase small subunit | - |
| N0J69_RS14235 | - | 2850605..2851041 (+) | 437 | Protein_2763 | hypothetical protein | - |
| N0J69_RS14240 | - | 2851147..2851590 (+) | 444 | WP_000022887.1 | GNAT family N-acetyltransferase | - |
| N0J69_RS14245 | - | 2852443..2853750 (-) | 1308 | WP_001045079.1 | TrkH family potassium uptake protein | - |
| N0J69_RS14250 | - | 2853911..2854822 (+) | 912 | WP_000825510.1 | iron-hydroxamate ABC transporter substrate-binding protein | - |
| N0J69_RS14255 | - | 2854884..2855729 (+) | 846 | WP_000812010.1 | class I SAM-dependent methyltransferase | - |
| N0J69_RS14260 | - | 2856101..2857324 (-) | 1224 | WP_000206639.1 | ArgE/DapE family deacylase | - |
| N0J69_RS14265 | lukH | 2857759..2858814 (+) | 1056 | WP_000791407.1 | bi-component leukocidin LukGH subunit H | - |
| N0J69_RS14270 | lukG | 2858836..2859852 (+) | 1017 | WP_000595324.1 | bi-component leukocidin LukGH subunit G | - |
| N0J69_RS14275 | sph | 2860090..2860914 (-) | 825 | Protein_2771 | sphingomyelin phosphodiesterase | - |
| N0J69_RS14280 | - | 2860971..2862008 (-) | 1038 | WP_000857199.1 | site-specific integrase | - |
| N0J69_RS14285 | - | 2862199..2862912 (-) | 714 | WP_001549185.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| N0J69_RS14290 | - | 2862990..2863172 (-) | 183 | WP_000705246.1 | hypothetical protein | - |
| N0J69_RS14295 | - | 2863376..2863717 (-) | 342 | WP_000591749.1 | hypothetical protein | - |
| N0J69_RS14300 | - | 2863723..2864655 (-) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| N0J69_RS14305 | - | 2864671..2865384 (-) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| N0J69_RS14310 | - | 2865347..2865520 (+) | 174 | WP_001801500.1 | hypothetical protein | - |
| N0J69_RS14315 | - | 2865517..2865780 (+) | 264 | WP_000854072.1 | helix-turn-helix transcriptional regulator | - |
| N0J69_RS14320 | - | 2865796..2866011 (+) | 216 | WP_001025404.1 | MW1434 family type I TA system toxin | - |
| N0J69_RS14325 | - | 2866000..2866329 (-) | 330 | WP_000180411.1 | hypothetical protein | - |
| N0J69_RS14330 | - | 2866380..2867132 (+) | 753 | WP_001148642.1 | phage antirepressor KilAC domain-containing protein | - |
| N0J69_RS14335 | - | 2867148..2867324 (+) | 177 | WP_001001356.1 | hypothetical protein | - |
| N0J69_RS14340 | - | 2867321..2867551 (-) | 231 | WP_000549548.1 | hypothetical protein | - |
| N0J69_RS14345 | - | 2867610..2867930 (+) | 321 | WP_001120199.1 | DUF771 domain-containing protein | - |
| N0J69_RS14350 | - | 2867927..2868088 (+) | 162 | WP_001285960.1 | DUF1270 domain-containing protein | - |
| N0J69_RS14355 | - | 2868183..2868443 (+) | 261 | WP_001549178.1 | DUF2482 family protein | - |
| N0J69_RS14360 | - | 2868483..2868743 (+) | 261 | WP_000291513.1 | DUF1108 family protein | - |
| N0J69_RS14365 | - | 2868752..2869015 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| N0J69_RS14370 | - | 2869024..2870967 (+) | 1944 | WP_000700561.1 | AAA family ATPase | - |
| N0J69_RS14375 | - | 2870969..2871889 (+) | 921 | WP_000138475.1 | recombinase RecT | - |
| N0J69_RS14380 | - | 2871970..2872587 (+) | 618 | WP_071665632.1 | MBL fold metallo-hydrolase | - |
| N0J69_RS14385 | ssbA | 2872588..2873058 (+) | 471 | WP_000934753.1 | single-stranded DNA-binding protein | Machinery gene |
| N0J69_RS14390 | - | 2873088..2873981 (+) | 894 | WP_000148333.1 | DnaD domain-containing protein | - |
| N0J69_RS14395 | - | 2873988..2874206 (+) | 219 | WP_000338530.1 | hypothetical protein | - |
| N0J69_RS14400 | - | 2874215..2874619 (+) | 405 | WP_000401977.1 | RusA family crossover junction endodeoxyribonuclease | - |
| N0J69_RS14405 | - | 2874632..2875000 (+) | 369 | WP_000101288.1 | SA1788 family PVL leukocidin-associated protein | - |
| N0J69_RS14410 | - | 2875004..2875246 (+) | 243 | WP_000131383.1 | phi PVL orf 51-like protein | - |
| N0J69_RS14415 | - | 2875255..2875626 (+) | 372 | WP_001549172.1 | hypothetical protein | - |
| N0J69_RS14420 | - | 2875619..2875855 (+) | 237 | WP_001065101.1 | DUF1024 family protein | - |
| N0J69_RS14425 | - | 2875845..2876087 (+) | 243 | WP_000700108.1 | hypothetical protein | - |
| N0J69_RS14430 | - | 2876080..2876613 (+) | 534 | WP_000181819.1 | dUTP diphosphatase | - |
| N0J69_RS14435 | - | 2876650..2876895 (+) | 246 | WP_001282074.1 | hypothetical protein | - |
| N0J69_RS14440 | - | 2876892..2877098 (+) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| N0J69_RS14445 | - | 2877095..2877481 (+) | 387 | WP_000592207.1 | hypothetical protein | - |
| N0J69_RS14450 | rinB | 2877478..2877627 (+) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| N0J69_RS14455 | - | 2877627..2877827 (+) | 201 | WP_000265043.1 | DUF1514 family protein | - |
| N0J69_RS14460 | - | 2877855..2878271 (+) | 417 | WP_000590122.1 | hypothetical protein | - |
| N0J69_RS14465 | - | 2878503..2878802 (+) | 300 | WP_000988336.1 | HNH endonuclease | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17668.55 Da Isoelectric Point: 5.2672
>NTDB_id=727079 N0J69_RS14385 WP_000934753.1 2872588..2873058(+) (ssbA) [Staphylococcus aureus strain 0831]
MLNRTILVGRLTRDPELRTTQNGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MLNRTILVGRLTRDPELRTTQNGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=727079 N0J69_RS14385 WP_000934753.1 2872588..2873058(+) (ssbA) [Staphylococcus aureus strain 0831]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAATGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAATGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
56.497 |
100 |
0.641 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50 |
100 |
0.545 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
33.333 |
100 |
0.378 |
| ssb | Neisseria meningitidis MC58 |
33.526 |
100 |
0.372 |
| ssb | Neisseria gonorrhoeae MS11 |
33.526 |
100 |
0.372 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
47.5 |
76.923 |
0.365 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
47.5 |
76.923 |
0.365 |