Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | NW951_RS11460 | Genome accession | NZ_CP102954 |
| Coordinates | 2317221..2317679 (-) | Length | 152 a.a. |
| NCBI ID | WP_258413115.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain 30-P-10 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2283829..2338305 | 2317221..2317679 | within | 0 |
Gene organization within MGE regions
Location: 2283829..2338305
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW951_RS11225 (NW951_11225) | - | 2283829..2284035 (-) | 207 | WP_251359519.1 | hypothetical protein | - |
| NW951_RS11230 (NW951_11230) | - | 2284635..2286089 (-) | 1455 | WP_258413099.1 | N-acetylmuramoyl-L-alanine amidase | - |
| NW951_RS11235 (NW951_11235) | - | 2286100..2286402 (-) | 303 | WP_251359527.1 | phage holin | - |
| NW951_RS11240 (NW951_11240) | - | 2286529..2286903 (-) | 375 | WP_000340977.1 | hypothetical protein | - |
| NW951_RS11245 (NW951_11245) | - | 2286959..2287246 (-) | 288 | WP_031763773.1 | hypothetical protein | - |
| NW951_RS11250 (NW951_11250) | - | 2287292..2287444 (-) | 153 | WP_258413100.1 | hypothetical protein | - |
| NW951_RS11255 (NW951_11255) | - | 2287437..2292044 (-) | 4608 | WP_258413101.1 | phage tail spike protein | - |
| NW951_RS11260 (NW951_11260) | - | 2292060..2293544 (-) | 1485 | WP_258411275.1 | phage tail family protein | - |
| NW951_RS11265 (NW951_11265) | - | 2293544..2298070 (-) | 4527 | WP_070004529.1 | phage tail tape measure protein | - |
| NW951_RS11270 (NW951_11270) | - | 2298127..2298261 (-) | 135 | WP_258413364.1 | hypothetical protein | - |
| NW951_RS11275 (NW951_11275) | - | 2298315..2298665 (-) | 351 | WP_031906184.1 | hypothetical protein | - |
| NW951_RS11280 (NW951_11280) | - | 2298715..2298954 (-) | 240 | WP_094969769.1 | Ig-like domain-containing protein | - |
| NW951_RS11285 (NW951_11285) | - | 2298981..2299625 (-) | 645 | WP_258413102.1 | major tail protein | - |
| NW951_RS11290 (NW951_11290) | - | 2299629..2300033 (-) | 405 | WP_000565500.1 | hypothetical protein | - |
| NW951_RS11295 (NW951_11295) | - | 2300030..2300434 (-) | 405 | WP_070004532.1 | HK97 gp10 family phage protein | - |
| NW951_RS11300 (NW951_11300) | - | 2300431..2300793 (-) | 363 | WP_031872356.1 | head-tail adaptor protein | - |
| NW951_RS11305 (NW951_11305) | - | 2300777..2301058 (-) | 282 | WP_258411279.1 | phage head-tail adapter protein | - |
| NW951_RS11310 (NW951_11310) | - | 2301067..2301345 (-) | 279 | WP_000005716.1 | hypothetical protein | - |
| NW951_RS11315 (NW951_11315) | - | 2301364..2302503 (-) | 1140 | WP_258413103.1 | phage major capsid protein | - |
| NW951_RS11320 (NW951_11320) | - | 2302527..2303249 (-) | 723 | WP_258413104.1 | head maturation protease, ClpP-related | - |
| NW951_RS11325 (NW951_11325) | - | 2303246..2304394 (-) | 1149 | WP_258413105.1 | phage portal protein | - |
| NW951_RS11330 (NW951_11330) | - | 2304409..2306070 (-) | 1662 | WP_258413106.1 | terminase large subunit | - |
| NW951_RS11335 (NW951_11335) | - | 2306067..2306411 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| NW951_RS11340 (NW951_11340) | - | 2306541..2306840 (-) | 300 | WP_000988332.1 | HNH endonuclease | - |
| NW951_RS11345 (NW951_11345) | - | 2307072..2307488 (-) | 417 | WP_000590126.1 | hypothetical protein | - |
| NW951_RS11350 (NW951_11350) | - | 2307516..2307716 (-) | 201 | WP_000265041.1 | DUF1514 family protein | - |
| NW951_RS11355 (NW951_11355) | - | 2307716..2307865 (-) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| NW951_RS11360 (NW951_11360) | - | 2307858..2308058 (-) | 201 | WP_258410179.1 | hypothetical protein | - |
| NW951_RS11365 (NW951_11365) | - | 2308055..2308261 (-) | 207 | WP_258410180.1 | DUF1381 domain-containing protein | - |
| NW951_RS11370 (NW951_11370) | - | 2308406..2308666 (-) | 261 | WP_258410181.1 | hypothetical protein | - |
| NW951_RS11375 (NW951_11375) | - | 2308703..2309224 (-) | 522 | WP_258410182.1 | dUTP diphosphatase | - |
| NW951_RS11385 (NW951_11385) | - | 2309580..2309705 (-) | 126 | Protein_2193 | DUF1024 family protein | - |
| NW951_RS11390 (NW951_11390) | - | 2309698..2310108 (-) | 411 | WP_258413107.1 | acetyltransferase | - |
| NW951_RS11395 (NW951_11395) | - | 2310105..2310614 (-) | 510 | WP_258412212.1 | hypothetical protein | - |
| NW951_RS11400 (NW951_11400) | - | 2310587..2311081 (-) | 495 | WP_258412213.1 | class I SAM-dependent methyltransferase | - |
| NW951_RS11405 (NW951_11405) | - | 2311078..2311515 (-) | 438 | WP_258413108.1 | YopX family protein | - |
| NW951_RS11410 (NW951_11410) | - | 2311512..2313056 (-) | 1545 | WP_258413109.1 | SAV1978 family virulence-associated passenger protein | - |
| NW951_RS11415 (NW951_11415) | - | 2313060..2313431 (-) | 372 | WP_258413110.1 | SA1788 family PVL leukocidin-associated protein | - |
| NW951_RS11420 (NW951_11420) | - | 2313444..2313848 (-) | 405 | WP_258413111.1 | RusA family crossover junction endodeoxyribonuclease | - |
| NW951_RS11425 (NW951_11425) | - | 2313858..2314079 (-) | 222 | WP_001123681.1 | DUF3269 family protein | - |
| NW951_RS11430 (NW951_11430) | - | 2314092..2314250 (-) | 159 | WP_000256589.1 | hypothetical protein | - |
| NW951_RS11435 (NW951_11435) | - | 2314244..2315023 (-) | 780 | WP_258413112.1 | ATP-binding protein | - |
| NW951_RS11440 (NW951_11440) | - | 2315033..2315836 (-) | 804 | WP_196576949.1 | phage replisome organizer N-terminal domain-containing protein | - |
| NW951_RS11445 (NW951_11445) | - | 2315808..2315903 (-) | 96 | Protein_2205 | putative HNHc nuclease | - |
| NW951_RS11450 (NW951_11450) | - | 2315890..2316543 (-) | 654 | WP_258413113.1 | NUMOD4 motif-containing HNH endonuclease | - |
| NW951_RS11455 (NW951_11455) | - | 2316544..2317209 (-) | 666 | WP_258413114.1 | putative HNHc nuclease | - |
| NW951_RS11460 (NW951_11460) | ssbA | 2317221..2317679 (-) | 459 | WP_258413115.1 | single-stranded DNA-binding protein | Machinery gene |
| NW951_RS11465 (NW951_11465) | - | 2317679..2318332 (-) | 654 | WP_258413116.1 | ERF family protein | - |
| NW951_RS11470 (NW951_11470) | - | 2318333..2318869 (-) | 537 | WP_023180128.1 | host-nuclease inhibitor Gam family protein | - |
| NW951_RS11475 (NW951_11475) | - | 2318882..2319142 (-) | 261 | WP_258413117.1 | DUF1108 family protein | - |
| NW951_RS11480 (NW951_11480) | - | 2319147..2319449 (-) | 303 | WP_258413118.1 | DUF2482 family protein | - |
| NW951_RS11485 (NW951_11485) | - | 2319542..2319703 (-) | 162 | WP_258413119.1 | DUF1270 domain-containing protein | - |
| NW951_RS11490 (NW951_11490) | - | 2319716..2319979 (-) | 264 | WP_115207353.1 | helix-turn-helix domain-containing protein | - |
| NW951_RS11495 (NW951_11495) | - | 2319994..2320749 (-) | 756 | WP_258413120.1 | phage regulatory protein/antirepressor Ant | - |
| NW951_RS11500 (NW951_11500) | - | 2320806..2321186 (+) | 381 | WP_209025522.1 | DUF2513 domain-containing protein | - |
| NW951_RS11505 (NW951_11505) | - | 2321173..2321370 (-) | 198 | WP_209025523.1 | hypothetical protein | - |
| NW951_RS11510 (NW951_11510) | - | 2321411..2321728 (-) | 318 | WP_196429542.1 | hypothetical protein | - |
| NW951_RS11515 (NW951_11515) | - | 2321744..2321962 (-) | 219 | WP_258413121.1 | helix-turn-helix transcriptional regulator | - |
| NW951_RS11520 (NW951_11520) | - | 2322105..2322824 (+) | 720 | WP_258413122.1 | XRE family transcriptional regulator | - |
| NW951_RS11525 (NW951_11525) | - | 2322835..2323692 (+) | 858 | WP_258413123.1 | HIRAN domain-containing protein | - |
| NW951_RS11530 (NW951_11530) | - | 2323875..2324498 (-) | 624 | WP_258411826.1 | hypothetical protein | - |
| NW951_RS11535 (NW951_11535) | - | 2324624..2325829 (+) | 1206 | WP_258411300.1 | site-specific integrase | - |
| NW951_RS11540 (NW951_11540) | - | 2325924..2326523 (-) | 600 | Protein_2224 | transcriptional regulator | - |
| NW951_RS11545 (NW951_11545) | - | 2326549..2328504 (-) | 1956 | WP_258413124.1 | AraC family transcriptional regulator | - |
| NW951_RS11550 (NW951_11550) | - | 2329114..2329923 (+) | 810 | WP_000717388.1 | CHAP domain-containing protein | - |
| NW951_RS11555 (NW951_11555) | - | 2329940..2330182 (-) | 243 | WP_001789136.1 | hypothetical protein | - |
| NW951_RS11560 (NW951_11560) | nhaC | 2330356..2331756 (-) | 1401 | WP_072357725.1 | Na+/H+ antiporter NhaC | - |
| NW951_RS11565 (NW951_11565) | - | 2331851..2332933 (-) | 1083 | WP_000684567.1 | NAD/NADP-dependent octopine/nopaline dehydrogenase family protein | - |
| NW951_RS11570 (NW951_11570) | - | 2333181..2333603 (+) | 423 | WP_000206109.1 | DUF4870 domain-containing protein | - |
| NW951_RS11575 (NW951_11575) | - | 2333840..2334340 (+) | 501 | WP_000737705.1 | CHAP domain-containing protein | - |
| NW951_RS11580 (NW951_11580) | - | 2334702..2335655 (+) | 954 | WP_000417016.1 | 2-hydroxyacid dehydrogenase family protein | - |
| NW951_RS11585 (NW951_11585) | - | 2335736..2336860 (-) | 1125 | WP_000684142.1 | FAD-dependent monooxygenase | - |
| NW951_RS11590 (NW951_11590) | - | 2337529..2338305 (-) | 777 | WP_000739224.1 | N-acetylglucosaminidase | - |
Sequence
Protein
Download Length: 152 a.a. Molecular weight: 17101.77 Da Isoelectric Point: 7.0140
>NTDB_id=720313 NW951_RS11460 WP_258413115.1 2317221..2317679(-) (ssbA) [Staphylococcus aureus strain 30-P-10]
MLNRTVLVGRLTKDPELRSTPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
NYENKDGQRVFVTEVVADSVQFLEPKNNNQQQNNNYQQQHNSYNAPQNRQQSNNPFANANGPIEISDDDLPF
MLNRTVLVGRLTKDPELRSTPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
NYENKDGQRVFVTEVVADSVQFLEPKNNNQQQNNNYQQQHNSYNAPQNRQQSNNPFANANGPIEISDDDLPF
Nucleotide
Download Length: 459 bp
>NTDB_id=720313 NW951_RS11460 WP_258413115.1 2317221..2317679(-) (ssbA) [Staphylococcus aureus strain 30-P-10]
ATGTTAAACAGAACAGTATTAGTAGGGCGATTAACAAAAGACCCAGAATTAAGAAGCACACCAAATGGCGTAAATGTAGG
TACATTCACATTAGCGGTAAACAGAACATTTACGAATGCTCAAGGCGAGCGTGAAGCAGACTTTATAAACGTAGTAGTGT
TCAAAAAACAAGCTGAAAACGTTAAAAACTACCTTTCTAAAGGTTCGCTGGCAGGTGTAGACGGACGGTTACAAACACGT
AACTACGAAAACAAAGACGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACAAAACAACAATTACCAACAACAGCACAATTCATATAACGCACCACAGAATAGACAGCAATCAAATA
ATCCATTCGCTAATGCTAATGGTCCTATAGAAATCTCTGACGATGACTTACCTTTCTAG
ATGTTAAACAGAACAGTATTAGTAGGGCGATTAACAAAAGACCCAGAATTAAGAAGCACACCAAATGGCGTAAATGTAGG
TACATTCACATTAGCGGTAAACAGAACATTTACGAATGCTCAAGGCGAGCGTGAAGCAGACTTTATAAACGTAGTAGTGT
TCAAAAAACAAGCTGAAAACGTTAAAAACTACCTTTCTAAAGGTTCGCTGGCAGGTGTAGACGGACGGTTACAAACACGT
AACTACGAAAACAAAGACGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACAAAACAACAATTACCAACAACAGCACAATTCATATAACGCACCACAGAATAGACAGCAATCAAATA
ATCCATTCGCTAATGCTAATGGTCCTATAGAAATCTCTGACGATGACTTACCTTTCTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
62.791 |
100 |
0.711 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
55.294 |
100 |
0.618 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
69.737 |
0.408 |
| ssb | Neisseria gonorrhoeae MS11 |
32.759 |
100 |
0.375 |
| ssb | Neisseria meningitidis MC58 |
32.759 |
100 |
0.375 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
48.696 |
75.658 |
0.368 |
| ssb | Glaesserella parasuis strain SC1401 |
31.638 |
100 |
0.368 |
| ssbA | Streptococcus mutans UA159 |
47.826 |
75.658 |
0.362 |