Detailed information NTG0699480

Bioinformatically predicted

Overview

• Name: comEA/comE1
• Type: Machinery gene
• Locus tag: L1F06_RS08975
• Genome accession: NZ_CP099397
• Coordinates: 1950390..1950713 (+)
• Length: 107 a.a.
• NCBI ID: WP_129483548.1
• Uniprot ID: -
• Organism: Pseudomonas hydrolytica strain DSWY01
• Function: dsDNA binding (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	1930553..1950295	1950390..1950713	flank	95

Gene organization within MGE regions

Location: 1930553..1950713

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
L1F06_RS08905 (L1F06_008905)	-	1930553..1933420 (+)	2868	WP_177491250.1	glycosyltransferase family 4 protein	-
L1F06_RS08910 (L1F06_008910)	-	1933417..1934358 (+)	942	WP_129483561.1	hypothetical protein	-
L1F06_RS08915 (L1F06_008915)	-	1934369..1935118 (+)	750	WP_129483560.1	hypothetical protein	-
L1F06_RS08920 (L1F06_008920)	-	1935142..1936005 (+)	864	WP_129483559.1	sulfotransferase domain-containing protein	-
L1F06_RS08925 (L1F06_008925)	-	1936002..1936751 (+)	750	WP_129483558.1	hypothetical protein	-
L1F06_RS08930 (L1F06_008930)	-	1936785..1938620 (+)	1836	WP_177491248.1	heparinase II/III family protein	-
L1F06_RS08935 (L1F06_008935)	cysC	1938726..1939313 (+)	588	WP_252576777.1	adenylyl-sulfate kinase	-
L1F06_RS08940 (L1F06_008940)	-	1939301..1941112 (+)	1812	WP_129483555.1	hypothetical protein	-
L1F06_RS08945 (L1F06_008945)	-	1941197..1942396 (+)	1200	WP_129483554.1	glycosyltransferase family 4 protein	-
L1F06_RS08950 (L1F06_008950)	-	1942423..1944978 (+)	2556	WP_129483553.1	acyltransferase family protein	-
L1F06_RS08955 (L1F06_008955)	-	1945037..1946227 (+)	1191	WP_129483552.1	glycosyltransferase family 4 protein	-
L1F06_RS08960 (L1F06_008960)	-	1946227..1947186 (+)	960	WP_129483551.1	NAD-dependent epimerase/dehydratase family protein	-
L1F06_RS08965 (L1F06_008965)	-	1947183..1948190 (+)	1008	WP_129483550.1	glycosyltransferase family 4 protein	-
L1F06_RS08970 (L1F06_008970)	-	1948295..1950295 (+)	2001	WP_129483549.1	nucleoside-diphosphate sugar epimerase/dehydratase	-
L1F06_RS08975 (L1F06_008975)	comEA/comE1	1950390..1950713 (+)	324	WP_129483548.1	helix-hairpin-helix domain-containing protein	Machinery gene

Sequence

Protein

• Length: 107 a.a.
• Molecular weight: 11095.68 Da
• Isoelectric Point: 7.0122

>NTDB_id=699480 L1F06_RS08975 WP_129483548.1 1950390..1950713(+) (comEA/comE1) [Pseudomonas hydrolytica strain DSWY01]
MLKARLSSLLFAVLASLSMAATAAESPKTESAKPAAVQSAQVATVNLNTADAATLQKELAGIGATKAQAIVAYREEHGNF
TSVDELLEVKGIGPATLEKNRDKLSVN

Nucleotide

• Length: 324 bp

>NTDB_id=699480 L1F06_RS08975 WP_129483548.1 1950390..1950713(+) (comEA/comE1) [Pseudomonas hydrolytica strain DSWY01]
ATGCTGAAAGCCCGTCTTTCTTCCCTGCTGTTCGCTGTTCTCGCTTCTCTCTCCATGGCTGCCACCGCGGCTGAGTCTCC
CAAAACCGAAAGTGCCAAGCCTGCAGCAGTGCAGTCTGCACAGGTGGCCACCGTCAATCTGAACACTGCCGATGCAGCGA
CCCTGCAGAAGGAGCTGGCAGGTATAGGTGCGACCAAGGCGCAGGCGATCGTTGCCTACCGTGAGGAGCATGGCAACTTC
ACTTCGGTTGACGAGTTGCTGGAGGTCAAGGGAATTGGCCCGGCAACGCTGGAGAAGAACCGCGACAAGTTGAGCGTGAA
CTGA

Domains

Predicted by InterproScan.

• Helix-hairpin-helix motif (HHH_3) (44-104)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comEA/comE1	Glaesserella parasuis strain SC1401	48.182	100	0.495
comEA	Vibrio cholerae strain A1552	45	93.458	0.421
comEA	Vibrio cholerae C6706	45	93.458	0.421
comEA	Legionella pneumophila str. Paris	41.748	96.262	0.402
comEA	Legionella pneumophila strain ERS1305867	41.748	96.262	0.402
comEA	Vibrio parahaemolyticus RIMD 2210633	43.299	90.654	0.393
comEA	Vibrio campbellii strain DS40M4	41.237	90.654	0.374
comEA	Acinetobacter baylyi ADP1	52	70.093	0.364
comE1/comEA	Haemophilus influenzae Rd KW20	65	56.075	0.364