Detailed information
Overview
| Name | comYC | Type | Machinery gene |
| Locus tag | EP162_RS06335 | Genome accession | NZ_AP018524 |
| Coordinates | 1469180..1469413 (-) | Length | 77 a.a. |
| NCBI ID | WP_013774257.1 | Uniprot ID | F3YBE3 |
| Organism | Melissococcus plutonius strain DAT585 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1464180..1474413
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EP162_RS06305 (DAT585_1279) | - | 1465153..1466346 (-) | 1194 | WP_127468702.1 | acetate kinase | - |
| EP162_RS06310 (DAT585_1280) | - | 1466375..1467382 (-) | 1008 | WP_013774253.1 | class I SAM-dependent methyltransferase | - |
| EP162_RS06315 (DAT585_1281) | comGG | 1467662..1468000 (-) | 339 | WP_268765908.1 | competence type IV pilus minor pilin ComGG | - |
| EP162_RS06320 (DAT585_1282) | comGF | 1467997..1468437 (-) | 441 | WP_053078316.1 | competence type IV pilus minor pilin ComGF | - |
| EP162_RS06325 (DAT585_1283) | - | 1468418..1468762 (-) | 345 | WP_041363232.1 | hypothetical protein | - |
| EP162_RS06330 (DAT585_1284) | comGD | 1468779..1469183 (-) | 405 | WP_013774256.1 | competence type IV pilus minor pilin ComGD | - |
| EP162_RS06335 (DAT585_1285) | comYC | 1469180..1469413 (-) | 234 | WP_013774257.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| EP162_RS06340 | - | 1469792..1470076 (-) | 285 | WP_041363488.1 | hypothetical protein | - |
| EP162_RS06345 (DAT585_1287) | - | 1470066..1470665 (-) | 600 | WP_013774259.1 | Panacea domain-containing protein | - |
| EP162_RS06350 (DAT585_1288) | - | 1471287..1472051 (-) | 765 | WP_268766437.1 | peptidoglycan amidohydrolase family protein | - |
| EP162_RS06355 (DAT585_1289) | - | 1472057..1472251 (-) | 195 | WP_013774261.1 | phage holin | - |
| EP162_RS06360 (DAT585_1290) | - | 1472253..1472495 (-) | 243 | WP_013774262.1 | hemolysin XhlA family protein | - |
| EP162_RS06365 (DAT585_1291) | - | 1472533..1472679 (-) | 147 | WP_013774263.1 | XkdX family protein | - |
| EP162_RS06370 (DAT585_1292) | - | 1472669..1473043 (-) | 375 | WP_013774264.1 | hypothetical protein | - |
| EP162_RS06375 (DAT585_1293) | - | 1473063..1473524 (-) | 462 | WP_048590192.1 | hypothetical protein | - |
| EP162_RS06380 (DAT585_1294) | - | 1473524..1474216 (-) | 693 | WP_013774265.1 | phage baseplate upper protein | - |
Sequence
Protein
Download Length: 77 a.a. Molecular weight: 8909.56 Da Isoelectric Point: 6.3134
>NTDB_id=69855 EP162_RS06335 WP_013774257.1 1469180..1469413(-) (comYC) [Melissococcus plutonius strain DAT585]
MLIVLLILSVLILLFVPNLAKQKETIDQKGNEAIVKVIEAQMELYELDKNVKPSAEQLLTEKYITKDQYEKYQTAKK
MLIVLLILSVLILLFVPNLAKQKETIDQKGNEAIVKVIEAQMELYELDKNVKPSAEQLLTEKYITKDQYEKYQTAKK
Nucleotide
Download Length: 234 bp
>NTDB_id=69855 EP162_RS06335 WP_013774257.1 1469180..1469413(-) (comYC) [Melissococcus plutonius strain DAT585]
ATGCTCATTGTTTTGCTTATTCTTTCTGTTTTAATTTTGTTATTTGTTCCAAATCTAGCAAAACAAAAAGAAACAATTGA
TCAAAAAGGAAATGAAGCAATTGTTAAAGTTATTGAAGCACAAATGGAATTATATGAATTAGACAAAAATGTAAAACCTT
CTGCTGAACAATTATTAACGGAAAAATACATTACTAAAGATCAATATGAAAAATATCAAACAGCTAAAAAATGA
ATGCTCATTGTTTTGCTTATTCTTTCTGTTTTAATTTTGTTATTTGTTCCAAATCTAGCAAAACAAAAAGAAACAATTGA
TCAAAAAGGAAATGAAGCAATTGTTAAAGTTATTGAAGCACAAATGGAATTATATGAATTAGACAAAAATGTAAAACCTT
CTGCTGAACAATTATTAACGGAAAAATACATTACTAAAGATCAATATGAAAAATATCAAACAGCTAAAAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comYC | Streptococcus suis isolate S10 |
53.247 |
100 |
0.532 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
54.795 |
94.805 |
0.519 |
| comGC/cglC | Streptococcus pneumoniae D39 |
54.795 |
94.805 |
0.519 |
| comGC/cglC | Streptococcus pneumoniae R6 |
54.795 |
94.805 |
0.519 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
54.795 |
94.805 |
0.519 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
53.333 |
97.403 |
0.519 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
44.118 |
88.312 |
0.39 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
50.847 |
76.623 |
0.39 |
| comGC/cglC | Streptococcus mitis SK321 |
50.847 |
76.623 |
0.39 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
47.458 |
76.623 |
0.364 |