Detailed information
Bioinformatically predicted
Overview
| Name | comYC | Type | Machinery gene |
| Locus tag | EP162_RS06335 | Genome accession | NZ_AP018524 |
| Coordinates | 1469180..1469413 (-) | Length | 77 a.a. |
| NCBI ID | WP_013774257.1 | Uniprot ID | F3YBE3 |
| Organism | Melissococcus plutonius strain DAT585 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1466375..1504638 | 1469180..1469413 | within | 0 |
Gene organization within MGE regions
Location: 1466375..1504638
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EP162_RS06310 (DAT585_1280) | - | 1466375..1467382 (-) | 1008 | WP_013774253.1 | class I SAM-dependent methyltransferase | - |
| EP162_RS06315 (DAT585_1281) | comGG | 1467662..1468000 (-) | 339 | WP_268765908.1 | competence type IV pilus minor pilin ComGG | - |
| EP162_RS06320 (DAT585_1282) | comGF | 1467997..1468437 (-) | 441 | WP_053078316.1 | competence type IV pilus minor pilin ComGF | - |
| EP162_RS06325 (DAT585_1283) | - | 1468418..1468762 (-) | 345 | WP_041363232.1 | hypothetical protein | - |
| EP162_RS06330 (DAT585_1284) | comGD | 1468779..1469183 (-) | 405 | WP_013774256.1 | competence type IV pilus minor pilin ComGD | - |
| EP162_RS06335 (DAT585_1285) | comYC | 1469180..1469413 (-) | 234 | WP_013774257.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| EP162_RS06340 | - | 1469792..1470076 (-) | 285 | WP_041363488.1 | hypothetical protein | - |
| EP162_RS06345 (DAT585_1287) | - | 1470066..1470665 (-) | 600 | WP_013774259.1 | Panacea domain-containing protein | - |
| EP162_RS06350 (DAT585_1288) | - | 1471287..1472051 (-) | 765 | WP_268766437.1 | peptidoglycan amidohydrolase family protein | - |
| EP162_RS06355 (DAT585_1289) | - | 1472057..1472251 (-) | 195 | WP_013774261.1 | phage holin | - |
| EP162_RS06360 (DAT585_1290) | - | 1472253..1472495 (-) | 243 | WP_013774262.1 | hemolysin XhlA family protein | - |
| EP162_RS06365 (DAT585_1291) | - | 1472533..1472679 (-) | 147 | WP_013774263.1 | XkdX family protein | - |
| EP162_RS06370 (DAT585_1292) | - | 1472669..1473043 (-) | 375 | WP_013774264.1 | hypothetical protein | - |
| EP162_RS06375 (DAT585_1293) | - | 1473063..1473524 (-) | 462 | WP_048590192.1 | hypothetical protein | - |
| EP162_RS06380 (DAT585_1294) | - | 1473524..1474216 (-) | 693 | WP_013774265.1 | phage baseplate upper protein | - |
| EP162_RS06385 (DAT585_1295) | - | 1474206..1474454 (-) | 249 | WP_013774266.1 | hypothetical protein | - |
| EP162_RS06390 (DAT585_1296) | - | 1474454..1475830 (-) | 1377 | WP_048590191.1 | phage tail protein | - |
| EP162_RS06395 (DAT585_1297) | - | 1475843..1476667 (-) | 825 | WP_013774268.1 | phage tail family protein | - |
| EP162_RS06400 (DAT585_1298) | - | 1476667..1478523 (-) | 1857 | WP_158309120.1 | transglycosylase SLT domain-containing protein | - |
| EP162_RS06405 (DAT585_1299) | - | 1479007..1480824 (-) | 1818 | WP_127468704.1 | tape measure protein | - |
| EP162_RS06410 (DAT585_1300) | - | 1480945..1481562 (-) | 618 | Protein_1278 | Gp15 family bacteriophage protein | - |
| EP162_RS06420 (DAT585_1302) | - | 1481698..1482000 (-) | 303 | WP_048594068.1 | hypothetical protein | - |
| EP162_RS06430 (DAT585_1303) | - | 1482306..1482827 (-) | 522 | WP_013774273.1 | phage tail tube protein | - |
| EP162_RS06435 (DAT585_1304) | - | 1482824..1483231 (-) | 408 | WP_048590187.1 | phage tail terminator protein | - |
| EP162_RS06440 (DAT585_1305) | - | 1483231..1483584 (-) | 354 | WP_013774275.1 | minor capsid protein | - |
| EP162_RS06445 (DAT585_1306) | - | 1483585..1483935 (-) | 351 | WP_013774276.1 | putative minor capsid protein | - |
| EP162_RS09390 (DAT585_1307) | - | 1483932..1484135 (-) | 204 | WP_232038649.1 | hypothetical protein | - |
| EP162_RS09395 (DAT585_1308) | - | 1484154..1484321 (-) | 168 | WP_013774278.1 | hypothetical protein | - |
| EP162_RS06455 (DAT585_1309) | - | 1484388..1485251 (-) | 864 | WP_048590186.1 | hypothetical protein | - |
| EP162_RS09710 | - | 1485263..1485841 (-) | 579 | Protein_1287 | phage scaffolding protein | - |
| EP162_RS06470 (DAT585_1312) | - | 1485952..1487088 (-) | 1137 | Protein_1288 | phage minor capsid protein | - |
| EP162_RS06475 (DAT585_1314) | - | 1487091..1488647 (-) | 1557 | WP_048590185.1 | phage portal protein | - |
| EP162_RS06480 | - | 1488664..1489916 (-) | 1253 | Protein_1290 | PBSX family phage terminase large subunit | - |
| EP162_RS06485 (DAT585_1318) | - | 1489982..1490491 (-) | 510 | WP_013774288.1 | terminase small subunit | - |
| EP162_RS09775 | - | 1490727..1490813 (-) | 87 | WP_221293899.1 | putative holin-like toxin | - |
| EP162_RS06490 (DAT585_1320) | - | 1491083..1491562 (-) | 480 | WP_145986062.1 | hypothetical protein | - |
| EP162_RS06495 (DAT585_1321) | - | 1491936..1492355 (-) | 420 | WP_013774291.1 | transcriptional regulator | - |
| EP162_RS06500 (DAT585_1322) | - | 1492369..1492635 (-) | 267 | WP_013774292.1 | hypothetical protein | - |
| EP162_RS06505 (DAT585_1323) | - | 1492625..1493011 (-) | 387 | WP_013774293.1 | hypothetical protein | - |
| EP162_RS06510 (DAT585_1324) | - | 1493012..1493212 (-) | 201 | WP_013774294.1 | hypothetical protein | - |
| EP162_RS06515 (DAT585_1325) | - | 1493313..1494059 (-) | 747 | WP_013774295.1 | hypothetical protein | - |
| EP162_RS06520 (DAT585_1326) | - | 1494066..1494485 (-) | 420 | WP_013774296.1 | hypothetical protein | - |
| EP162_RS06525 (DAT585_1327) | - | 1494516..1494935 (-) | 420 | WP_013774297.1 | RusA family crossover junction endodeoxyribonuclease | - |
| EP162_RS09780 (DAT585_1328) | - | 1494953..1495249 (-) | 297 | WP_013774298.1 | single-stranded DNA-binding protein | - |
| EP162_RS09785 (DAT585_1329) | ssb | 1495276..1495458 (-) | 183 | WP_013774299.1 | single-stranded DNA-binding protein | Machinery gene |
| EP162_RS06535 (DAT585_1330) | - | 1495455..1496015 (-) | 561 | WP_048590183.1 | hypothetical protein | - |
| EP162_RS09790 (DAT585_1331) | - | 1496461..1496880 (-) | 420 | WP_414973931.1 | phage replisome organizer N-terminal domain-containing protein | - |
| EP162_RS06545 (DAT585_1332) | - | 1496920..1497606 (-) | 687 | WP_013774302.1 | putative HNHc nuclease | - |
| EP162_RS06550 (DAT585_1333) | - | 1497714..1498424 (-) | 711 | WP_231849634.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| EP162_RS06555 (DAT585_1334) | bet | 1498375..1499103 (-) | 729 | WP_013774304.1 | phage recombination protein Bet | - |
| EP162_RS06560 (DAT585_1335) | - | 1499096..1499404 (-) | 309 | WP_013774305.1 | hypothetical protein | - |
| EP162_RS09105 (DAT585_1336) | - | 1499459..1499599 (-) | 141 | WP_013774306.1 | hypothetical protein | - |
| EP162_RS06565 (DAT585_1337) | - | 1499596..1499787 (-) | 192 | WP_013774307.1 | hypothetical protein | - |
| EP162_RS06570 (DAT585_1338) | - | 1499774..1499953 (-) | 180 | WP_013774308.1 | hypothetical protein | - |
| EP162_RS06575 (DAT585_1339) | - | 1499966..1500724 (-) | 759 | WP_013774309.1 | phage repressor protein/antirepressor Ant | - |
| EP162_RS06580 (DAT585_1340) | - | 1500721..1500963 (-) | 243 | WP_013774310.1 | helix-turn-helix transcriptional regulator | - |
| EP162_RS06585 (DAT585_1341) | - | 1501149..1501865 (+) | 717 | WP_041363490.1 | XRE family transcriptional regulator | - |
| EP162_RS06590 (DAT585_1342) | - | 1501970..1502641 (+) | 672 | WP_053078312.1 | hypothetical protein | - |
| EP162_RS06595 (DAT585_1343) | - | 1502739..1503083 (+) | 345 | WP_127468707.1 | hypothetical protein | - |
| EP162_RS09795 | - | 1503203..1504638 (+) | 1436 | Protein_1317 | recombinase family protein | - |
Sequence
Protein
Download Length: 77 a.a. Molecular weight: 8909.56 Da Isoelectric Point: 6.3134
>NTDB_id=69855 EP162_RS06335 WP_013774257.1 1469180..1469413(-) (comYC) [Melissococcus plutonius strain DAT585]
MLIVLLILSVLILLFVPNLAKQKETIDQKGNEAIVKVIEAQMELYELDKNVKPSAEQLLTEKYITKDQYEKYQTAKK
MLIVLLILSVLILLFVPNLAKQKETIDQKGNEAIVKVIEAQMELYELDKNVKPSAEQLLTEKYITKDQYEKYQTAKK
Nucleotide
Download Length: 234 bp
>NTDB_id=69855 EP162_RS06335 WP_013774257.1 1469180..1469413(-) (comYC) [Melissococcus plutonius strain DAT585]
ATGCTCATTGTTTTGCTTATTCTTTCTGTTTTAATTTTGTTATTTGTTCCAAATCTAGCAAAACAAAAAGAAACAATTGA
TCAAAAAGGAAATGAAGCAATTGTTAAAGTTATTGAAGCACAAATGGAATTATATGAATTAGACAAAAATGTAAAACCTT
CTGCTGAACAATTATTAACGGAAAAATACATTACTAAAGATCAATATGAAAAATATCAAACAGCTAAAAAATGA
ATGCTCATTGTTTTGCTTATTCTTTCTGTTTTAATTTTGTTATTTGTTCCAAATCTAGCAAAACAAAAAGAAACAATTGA
TCAAAAAGGAAATGAAGCAATTGTTAAAGTTATTGAAGCACAAATGGAATTATATGAATTAGACAAAAATGTAAAACCTT
CTGCTGAACAATTATTAACGGAAAAATACATTACTAAAGATCAATATGAAAAATATCAAACAGCTAAAAAATGA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comYC | Streptococcus suis isolate S10 |
53.247 |
100 |
0.532 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
54.795 |
94.805 |
0.519 |
| comGC/cglC | Streptococcus pneumoniae D39 |
54.795 |
94.805 |
0.519 |
| comGC/cglC | Streptococcus pneumoniae R6 |
54.795 |
94.805 |
0.519 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
54.795 |
94.805 |
0.519 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
53.333 |
97.403 |
0.519 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
44.118 |
88.312 |
0.39 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
50.847 |
76.623 |
0.39 |
| comGC/cglC | Streptococcus mitis SK321 |
50.847 |
76.623 |
0.39 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
47.458 |
76.623 |
0.364 |