Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | MUY23_RS03180 | Genome accession | NZ_CP095162 |
| Coordinates | 631082..631297 (+) | Length | 71 a.a. |
| NCBI ID | WP_024395066.1 | Uniprot ID | - |
| Organism | Streptococcus suis strain TJS75 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 600352..634889 | 631082..631297 | within | 0 |
| IS/Tn | 629493..630695 | 631082..631297 | flank | 387 |
Gene organization within MGE regions
Location: 600352..634889
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MUY23_RS02940 | clpP | 600352..600942 (+) | 591 | WP_002937303.1 | ATP-dependent Clp protease proteolytic subunit | Regulator |
| MUY23_RS02945 | - | 601069..601341 (+) | 273 | WP_002937299.1 | YlbG family protein | - |
| MUY23_RS02950 | - | 601472..602641 (+) | 1170 | WP_002937297.1 | ABC transporter substrate-binding protein | - |
| MUY23_RS02955 | - | 602847..603734 (+) | 888 | WP_002937296.1 | branched-chain amino acid ABC transporter permease | - |
| MUY23_RS02960 | - | 603737..604684 (+) | 948 | WP_002937293.1 | branched-chain amino acid ABC transporter permease | - |
| MUY23_RS02965 | - | 604684..605448 (+) | 765 | WP_002937291.1 | ABC transporter ATP-binding protein | - |
| MUY23_RS02970 | - | 605448..606158 (+) | 711 | WP_002937288.1 | ABC transporter ATP-binding protein | - |
| MUY23_RS02975 | - | 606529..607284 (+) | 756 | WP_002937287.1 | epoxyqueuosine reductase QueH | - |
| MUY23_RS02980 | - | 607392..607982 (+) | 591 | WP_013730461.1 | hypothetical protein | - |
| MUY23_RS02985 | holA | 608132..609163 (+) | 1032 | WP_024381608.1 | DNA polymerase III subunit delta | - |
| MUY23_RS02990 | sodA | 609276..609881 (+) | 606 | WP_024381607.1 | superoxide dismutase SodA | - |
| MUY23_RS02995 | - | 610143..612167 (+) | 2025 | WP_023370923.1 | bifunctional metallophosphatase/5'-nucleotidase | - |
| MUY23_RS03005 | - | 612474..613568 (-) | 1095 | WP_061286144.1 | tyrosine-type recombinase/integrase | - |
| MUY23_RS03010 | - | 613694..614128 (-) | 435 | WP_014636688.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| MUY23_RS03015 | - | 614303..615058 (-) | 756 | WP_024417671.1 | XRE family transcriptional regulator | - |
| MUY23_RS03020 | - | 615201..615365 (+) | 165 | WP_153308570.1 | hypothetical protein | - |
| MUY23_RS03025 | - | 615514..615819 (+) | 306 | WP_029743813.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MUY23_RS11750 | - | 615809..615937 (-) | 129 | WP_255199034.1 | hypothetical protein | - |
| MUY23_RS03030 | - | 616080..616280 (+) | 201 | WP_024417669.1 | helix-turn-helix transcriptional regulator | - |
| MUY23_RS03035 | - | 616295..616480 (+) | 186 | WP_004194666.1 | helix-turn-helix transcriptional regulator | - |
| MUY23_RS03040 | - | 616516..616737 (+) | 222 | WP_004195135.1 | hypothetical protein | - |
| MUY23_RS11755 | - | 616751..616882 (+) | 132 | WP_255199035.1 | hypothetical protein | - |
| MUY23_RS03045 | - | 616833..617522 (-) | 690 | WP_014636681.1 | DUF4145 domain-containing protein | - |
| MUY23_RS03050 | - | 617576..618286 (+) | 711 | WP_014636680.1 | phage antirepressor KilAC domain-containing protein | - |
| MUY23_RS03055 | - | 618641..618898 (+) | 258 | WP_014636678.1 | hypothetical protein | - |
| MUY23_RS03060 | - | 618879..619103 (+) | 225 | WP_004194648.1 | hypothetical protein | - |
| MUY23_RS03065 | - | 619156..619521 (+) | 366 | WP_004194647.1 | hypothetical protein | - |
| MUY23_RS03070 | - | 619842..619985 (+) | 144 | WP_014636677.1 | hypothetical protein | - |
| MUY23_RS11760 | - | 619996..620124 (+) | 129 | WP_014636676.1 | hypothetical protein | - |
| MUY23_RS03075 | - | 620124..620303 (+) | 180 | WP_004195116.1 | hypothetical protein | - |
| MUY23_RS03080 | bet | 620300..621070 (+) | 771 | WP_044769722.1 | phage recombination protein Bet | - |
| MUY23_RS03085 | - | 621080..622108 (+) | 1029 | WP_014636674.1 | DUF1351 domain-containing protein | - |
| MUY23_RS03090 | - | 622111..622380 (+) | 270 | WP_002937957.1 | hypothetical protein | - |
| MUY23_RS03095 | - | 622390..622716 (+) | 327 | WP_002937956.1 | hypothetical protein | - |
| MUY23_RS03100 | - | 622706..622885 (+) | 180 | WP_002937955.1 | hypothetical protein | - |
| MUY23_RS03105 | ssbA | 622988..623425 (+) | 438 | WP_341643189.1 | single-stranded DNA-binding protein | Machinery gene |
| MUY23_RS03110 | - | 623453..623827 (+) | 375 | WP_002937949.1 | hypothetical protein | - |
| MUY23_RS03115 | - | 624140..624472 (+) | 333 | WP_002937944.1 | hypothetical protein | - |
| MUY23_RS03120 | - | 624469..624987 (+) | 519 | WP_002937943.1 | hypothetical protein | - |
| MUY23_RS03125 | - | 625042..625299 (+) | 258 | WP_230334151.1 | DUF1372 family protein | - |
| MUY23_RS03130 | - | 625315..625548 (+) | 234 | WP_002937935.1 | hypothetical protein | - |
| MUY23_RS03135 | - | 625548..625724 (+) | 177 | WP_002937925.1 | hypothetical protein | - |
| MUY23_RS03140 | - | 625724..625993 (+) | 270 | WP_002937922.1 | hypothetical protein | - |
| MUY23_RS03145 | - | 626005..626256 (+) | 252 | WP_002937919.1 | hypothetical protein | - |
| MUY23_RS03150 | - | 626333..626767 (+) | 435 | WP_002937915.1 | DUF1492 domain-containing protein | - |
| MUY23_RS03155 | - | 626864..627211 (+) | 348 | WP_002937914.1 | HNH endonuclease signature motif containing protein | - |
| MUY23_RS03160 | - | 627290..627652 (+) | 363 | WP_002937910.1 | hypothetical protein | - |
| MUY23_RS03165 | - | 627649..628914 (+) | 1266 | WP_002937907.1 | phage portal protein | - |
| MUY23_RS03170 | - | 628907..629308 (+) | 402 | Protein_609 | hypothetical protein | - |
| MUY23_RS03175 | - | 629493..630695 (-) | 1203 | WP_002935596.1 | IS110 family transposase | - |
| MUY23_RS03180 | prx | 631082..631297 (+) | 216 | WP_024395066.1 | hypothetical protein | Regulator |
| MUY23_RS03185 | - | 631416..632630 (-) | 1215 | WP_024390438.1 | chloride channel protein | - |
| MUY23_RS03190 | - | 632620..632898 (-) | 279 | WP_013730456.1 | chorismate mutase | - |
| MUY23_RS03195 | rpsN | 632980..633249 (-) | 270 | WP_002940393.1 | 30S ribosomal protein S14 | - |
| MUY23_RS03200 | - | 633389..633850 (-) | 462 | WP_012775265.1 | flavodoxin | - |
| MUY23_RS03205 | - | 633945..634889 (+) | 945 | WP_013730455.1 | bifunctional oligoribonuclease/PAP phosphatase NrnA | - |
Sequence
Protein
Download Length: 71 a.a. Molecular weight: 8355.57 Da Isoelectric Point: 4.8537
>NTDB_id=675831 MUY23_RS03180 WP_024395066.1 631082..631297(+) (prx) [Streptococcus suis strain TJS75]
MLEYEELKQAVDDGYITGDTVNIVRRDGKIFDYVLPGEEVRPWEVVREEKVVDVMRELKSSPQIRPKSFKK
MLEYEELKQAVDDGYITGDTVNIVRRDGKIFDYVLPGEEVRPWEVVREEKVVDVMRELKSSPQIRPKSFKK
Nucleotide
Download Length: 216 bp
>NTDB_id=675831 MUY23_RS03180 WP_024395066.1 631082..631297(+) (prx) [Streptococcus suis strain TJS75]
ATGTTAGAATACGAAGAATTAAAACAAGCAGTAGATGACGGATATATTACAGGCGATACAGTAAATATCGTACGTCGTGA
CGGCAAGATATTTGATTATGTTTTGCCAGGCGAAGAGGTCAGACCATGGGAAGTAGTGAGAGAAGAGAAAGTAGTGGATG
TGATGAGGGAATTGAAGTCGTCGCCCCAAATCCGCCCCAAAAGTTTTAAAAAATGA
ATGTTAGAATACGAAGAATTAAAACAAGCAGTAGATGACGGATATATTACAGGCGATACAGTAAATATCGTACGTCGTGA
CGGCAAGATATTTGATTATGTTTTGCCAGGCGAAGAGGTCAGACCATGGGAAGTAGTGAGAGAAGAGAAAGTAGTGGATG
TGATGAGGGAATTGAAGTCGTCGCCCCAAATCCGCCCCAAAAGTTTTAAAAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
68.966 |
81.69 |
0.563 |
| prx | Streptococcus pyogenes MGAS315 |
65.517 |
81.69 |
0.535 |
| prx | Streptococcus pyogenes MGAS8232 |
65.517 |
81.69 |
0.535 |
| prx | Streptococcus pyogenes MGAS315 |
60.345 |
81.69 |
0.493 |
| prx | Streptococcus pyogenes MGAS315 |
73.81 |
59.155 |
0.437 |
| prx | Streptococcus pyogenes MGAS315 |
73.171 |
57.746 |
0.423 |
| prx | Streptococcus pyogenes MGAS315 |
68.293 |
57.746 |
0.394 |