Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | MTO79_RS12395 | Genome accession | NZ_CP094474 |
| Coordinates | 2423499..2423768 (-) | Length | 89 a.a. |
| NCBI ID | WP_003129998.1 | Uniprot ID | - |
| Organism | Lactococcus lactis strain SCB469 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2420508..2456373 | 2423499..2423768 | within | 0 |
Gene organization within MGE regions
Location: 2420508..2456373
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MTO79_RS12365 (MTO79_12365) | - | 2420508..2420945 (-) | 438 | WP_003129992.1 | zinc-dependent MarR family transcriptional regulator | - |
| MTO79_RS12370 (MTO79_12370) | - | 2421152..2422099 (+) | 948 | WP_003130410.1 | IS30 family transposase | - |
| MTO79_RS12375 (MTO79_12375) | comGG | 2422073..2422399 (-) | 327 | WP_058221568.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| MTO79_RS12380 (MTO79_12380) | comGF | 2422449..2422877 (-) | 429 | Protein_2393 | competence type IV pilus minor pilin ComGF | - |
| MTO79_RS12385 (MTO79_12385) | comGE | 2422840..2423136 (-) | 297 | WP_010906316.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| MTO79_RS12390 (MTO79_12390) | comGD | 2423108..2423539 (-) | 432 | WP_080585155.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| MTO79_RS12395 (MTO79_12395) | comGC | 2423499..2423768 (-) | 270 | WP_003129998.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| MTO79_RS12400 (MTO79_12400) | - | 2423895..2424587 (-) | 693 | WP_152994386.1 | hypothetical protein | - |
| MTO79_RS12405 (MTO79_12405) | - | 2424829..2425608 (-) | 780 | WP_082225220.1 | peptidoglycan amidohydrolase family protein | - |
| MTO79_RS12410 (MTO79_12410) | - | 2425608..2425907 (-) | 300 | WP_031559226.1 | phage holin | - |
| MTO79_RS12415 (MTO79_12415) | - | 2425920..2426270 (-) | 351 | WP_014570798.1 | hypothetical protein | - |
| MTO79_RS12420 (MTO79_12420) | - | 2426283..2426519 (-) | 237 | WP_082225257.1 | hypothetical protein | - |
| MTO79_RS12425 (MTO79_12425) | - | 2426531..2430796 (-) | 4266 | WP_243525488.1 | hypothetical protein | - |
| MTO79_RS12430 (MTO79_12430) | - | 2430775..2432304 (-) | 1530 | WP_003131327.1 | distal tail protein Dit | - |
| MTO79_RS12435 (MTO79_12435) | - | 2432314..2434923 (-) | 2610 | WP_058221395.1 | phage tail tape measure protein | - |
| MTO79_RS12440 (MTO79_12440) | - | 2434913..2435620 (-) | 708 | WP_003131324.1 | Gp15 family bacteriophage protein | - |
| MTO79_RS12445 (MTO79_12445) | - | 2435636..2436043 (-) | 408 | WP_058221396.1 | hypothetical protein | - |
| MTO79_RS12450 (MTO79_12450) | - | 2436100..2436576 (-) | 477 | WP_014570559.1 | hypothetical protein | - |
| MTO79_RS12455 (MTO79_12455) | - | 2436587..2437021 (-) | 435 | WP_003131321.1 | minor capsid protein | - |
| MTO79_RS12460 (MTO79_12460) | - | 2437021..2437350 (-) | 330 | WP_003131320.1 | hypothetical protein | - |
| MTO79_RS12465 (MTO79_12465) | - | 2437347..2437691 (-) | 345 | WP_014570557.1 | putative minor capsid protein | - |
| MTO79_RS12470 (MTO79_12470) | - | 2437681..2438082 (-) | 402 | WP_014570556.1 | hypothetical protein | - |
| MTO79_RS12475 (MTO79_12475) | - | 2438156..2438392 (-) | 237 | WP_014570555.1 | Ig-like domain-containing protein | - |
| MTO79_RS12480 (MTO79_12480) | - | 2438421..2439338 (-) | 918 | WP_003131315.1 | hypothetical protein | - |
| MTO79_RS12485 (MTO79_12485) | - | 2439353..2440402 (-) | 1050 | WP_003131314.1 | XkdF-like putative serine protease domain-containing protein | - |
| MTO79_RS12490 (MTO79_12490) | - | 2440418..2441248 (-) | 831 | WP_003131311.1 | phage minor head protein | - |
| MTO79_RS12495 (MTO79_12495) | - | 2441241..2442770 (-) | 1530 | WP_058221397.1 | phage portal protein | - |
| MTO79_RS12500 (MTO79_12500) | terL | 2442783..2444225 (-) | 1443 | WP_124156151.1 | phage terminase large subunit | - |
| MTO79_RS12505 (MTO79_12505) | - | 2444215..2444688 (-) | 474 | WP_058221398.1 | transposase | - |
| MTO79_RS12510 (MTO79_12510) | - | 2444860..2445249 (-) | 390 | WP_058221399.1 | DUF722 domain-containing protein | - |
| MTO79_RS12515 (MTO79_12515) | - | 2445326..2445634 (-) | 309 | WP_082225258.1 | hypothetical protein | - |
| MTO79_RS12520 (MTO79_12520) | - | 2445763..2445978 (-) | 216 | WP_058221541.1 | DUF1660 domain-containing protein | - |
| MTO79_RS12525 (MTO79_12525) | - | 2445975..2446193 (-) | 219 | WP_014570803.1 | hypothetical protein | - |
| MTO79_RS12530 (MTO79_12530) | - | 2446212..2446931 (-) | 720 | WP_082225259.1 | hypothetical protein | - |
| MTO79_RS12535 (MTO79_12535) | - | 2446958..2447317 (-) | 360 | WP_082225260.1 | hypothetical protein | - |
| MTO79_RS12540 (MTO79_12540) | dut | 2447321..2447740 (-) | 420 | WP_082225261.1 | dUTP diphosphatase | - |
| MTO79_RS12545 (MTO79_12545) | - | 2447737..2448102 (-) | 366 | WP_082225262.1 | DUF1642 domain-containing protein | - |
| MTO79_RS12550 (MTO79_12550) | - | 2448099..2448641 (-) | 543 | WP_145952586.1 | DUF1642 domain-containing protein | - |
| MTO79_RS12555 (MTO79_12555) | - | 2448634..2448816 (-) | 183 | WP_243525495.1 | hypothetical protein | - |
| MTO79_RS12560 (MTO79_12560) | - | 2448835..2448993 (-) | 159 | WP_228763273.1 | hypothetical protein | - |
| MTO79_RS12565 (MTO79_12565) | - | 2449185..2449391 (-) | 207 | WP_014570535.1 | hypothetical protein | - |
| MTO79_RS12570 (MTO79_12570) | - | 2449499..2449909 (-) | 411 | WP_014570810.1 | hypothetical protein | - |
| MTO79_RS12575 (MTO79_12575) | - | 2449922..2450194 (-) | 273 | WP_145952588.1 | L-rhamnose isomerase | - |
| MTO79_RS12580 (MTO79_12580) | - | 2450157..2450318 (-) | 162 | WP_158521330.1 | hypothetical protein | - |
| MTO79_RS12585 (MTO79_12585) | - | 2450357..2451283 (-) | 927 | WP_058221710.1 | phage replisome organizer N-terminal domain-containing protein | - |
| MTO79_RS12590 (MTO79_12590) | - | 2451546..2452613 (-) | 1068 | WP_058221711.1 | DUF1351 domain-containing protein | - |
| MTO79_RS12595 (MTO79_12595) | bet | 2452615..2453352 (-) | 738 | WP_058212836.1 | phage recombination protein Bet | - |
| MTO79_RS12600 (MTO79_12600) | - | 2453459..2453635 (-) | 177 | WP_032943269.1 | putative transcriptional regulator | - |
| MTO79_RS12605 (MTO79_12605) | - | 2453632..2453880 (-) | 249 | WP_058221712.1 | hypothetical protein | - |
| MTO79_RS14075 | - | 2453893..2454015 (-) | 123 | WP_023164646.1 | hypothetical protein | - |
| MTO79_RS12610 (MTO79_12610) | - | 2454012..2454194 (-) | 183 | WP_003130605.1 | hypothetical protein | - |
| MTO79_RS12615 (MTO79_12615) | - | 2454210..2454899 (-) | 690 | WP_058221713.1 | Rha family transcriptional regulator | - |
| MTO79_RS12620 (MTO79_12620) | - | 2454958..2455191 (-) | 234 | WP_014570819.1 | transcriptional regulator | - |
| MTO79_RS12625 (MTO79_12625) | - | 2455368..2455778 (+) | 411 | WP_014570820.1 | helix-turn-helix transcriptional regulator | - |
| MTO79_RS12630 (MTO79_12630) | - | 2455789..2456373 (+) | 585 | WP_058221714.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 89 a.a. Molecular weight: 10123.56 Da Isoelectric Point: 4.2950
>NTDB_id=669821 MTO79_RS12395 WP_003129998.1 2423499..2423768(-) (comGC) [Lactococcus lactis strain SCB469]
MLIVLAIISILILLFVPNLIKEKSQVQKTGEAAVVKVVESQAQLYELDHDDEKPSLPELLSAGMITQKQISAYDNYYDQN
KNEERNFND
MLIVLAIISILILLFVPNLIKEKSQVQKTGEAAVVKVVESQAQLYELDHDDEKPSLPELLSAGMITQKQISAYDNYYDQN
KNEERNFND
Nucleotide
Download Length: 270 bp
>NTDB_id=669821 MTO79_RS12395 WP_003129998.1 2423499..2423768(-) (comGC) [Lactococcus lactis strain SCB469]
ATGTTAATTGTACTAGCTATTATTAGTATTTTAATATTACTATTTGTTCCAAATTTAATTAAAGAAAAATCACAAGTTCA
AAAAACTGGAGAAGCGGCAGTTGTAAAAGTAGTAGAAAGTCAAGCTCAACTTTATGAATTAGATCATGATGATGAGAAGC
CGAGTCTGCCAGAATTGCTCAGCGCTGGGATGATTACTCAAAAACAAATTTCTGCTTACGATAATTACTATGATCAGAAC
AAAAATGAAGAACGAAATTTTAATGACTAG
ATGTTAATTGTACTAGCTATTATTAGTATTTTAATATTACTATTTGTTCCAAATTTAATTAAAGAAAAATCACAAGTTCA
AAAAACTGGAGAAGCGGCAGTTGTAAAAGTAGTAGAAAGTCAAGCTCAACTTTATGAATTAGATCATGATGATGAGAAGC
CGAGTCTGCCAGAATTGCTCAGCGCTGGGATGATTACTCAAAAACAAATTTCTGCTTACGATAATTACTATGATCAGAAC
AAAAATGAAGAACGAAATTTTAATGACTAG
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Lactococcus lactis subsp. cremoris KW2 |
86.667 |
84.27 |
0.73 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
55.056 |
100 |
0.551 |
| comGC/cglC | Streptococcus pneumoniae D39 |
55.056 |
100 |
0.551 |
| comGC/cglC | Streptococcus pneumoniae R6 |
55.056 |
100 |
0.551 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
55.056 |
100 |
0.551 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.471 |
95.506 |
0.539 |
| comYC | Streptococcus suis isolate S10 |
58.904 |
82.022 |
0.483 |
| comGC/cglC | Streptococcus mitis SK321 |
53.947 |
85.393 |
0.461 |
| comYC | Streptococcus mutans UA140 |
50.685 |
82.022 |
0.416 |
| comYC | Streptococcus mutans UA159 |
50.685 |
82.022 |
0.416 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
56.25 |
71.91 |
0.404 |