Detailed information
Bioinformatically predicted
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | LP473_RS10775 | Genome accession | NZ_CP087699 |
| Coordinates | 2155913..2156182 (-) | Length | 89 a.a. |
| NCBI ID | WP_003129998.1 | Uniprot ID | - |
| Organism | Lactococcus lactis subsp. lactis strain IBB417 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2157087..2200086 | 2155913..2156182 | flank | 905 |
Gene organization within MGE regions
Location: 2155913..2200086
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LP473_RS10775 (LP473_10780) | comGC | 2155913..2156182 (-) | 270 | WP_003129998.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| LP473_RS10780 (LP473_10785) | - | 2156288..2157007 (-) | 720 | WP_095345449.1 | hypothetical protein | - |
| LP473_RS10785 (LP473_10790) | - | 2157087..2157866 (-) | 780 | WP_252174746.1 | peptidoglycan amidohydrolase family protein | - |
| LP473_RS10790 (LP473_10795) | - | 2157866..2158165 (-) | 300 | WP_252174747.1 | phage holin | - |
| LP473_RS10795 (LP473_10800) | - | 2158178..2158528 (-) | 351 | WP_014570798.1 | hypothetical protein | - |
| LP473_RS10800 (LP473_10805) | - | 2158541..2158777 (-) | 237 | WP_081196280.1 | hypothetical protein | - |
| LP473_RS10805 (LP473_10810) | - | 2158789..2160567 (-) | 1779 | WP_252174748.1 | hypothetical protein | - |
| LP473_RS10810 (LP473_10815) | - | 2160545..2160718 (-) | 174 | WP_252174749.1 | hypothetical protein | - |
| LP473_RS10815 (LP473_10820) | - | 2160718..2161839 (-) | 1122 | WP_252174750.1 | hypothetical protein | - |
| LP473_RS10820 (LP473_10825) | - | 2161855..2163666 (-) | 1812 | WP_252174751.1 | phage tail protein | - |
| LP473_RS10825 (LP473_10830) | - | 2163645..2165174 (-) | 1530 | WP_252174752.1 | distal tail protein Dit | - |
| LP473_RS10830 (LP473_10835) | - | 2165184..2167793 (-) | 2610 | WP_252174753.1 | phage tail tape measure protein | - |
| LP473_RS10835 (LP473_10840) | - | 2167783..2168490 (-) | 708 | WP_014570560.1 | Gp15 family bacteriophage protein | - |
| LP473_RS10840 (LP473_10845) | - | 2168506..2168913 (-) | 408 | WP_003131323.1 | hypothetical protein | - |
| LP473_RS10845 (LP473_10850) | - | 2168970..2169446 (-) | 477 | WP_014570559.1 | hypothetical protein | - |
| LP473_RS10850 (LP473_10855) | - | 2169457..2169891 (-) | 435 | WP_003131321.1 | minor capsid protein | - |
| LP473_RS10855 (LP473_10860) | - | 2169891..2170220 (-) | 330 | WP_003131320.1 | hypothetical protein | - |
| LP473_RS10860 (LP473_10865) | - | 2170217..2170561 (-) | 345 | WP_014570557.1 | putative minor capsid protein | - |
| LP473_RS10865 (LP473_10870) | - | 2170551..2170952 (-) | 402 | WP_014570556.1 | hypothetical protein | - |
| LP473_RS10870 (LP473_10875) | - | 2171026..2171262 (-) | 237 | WP_252174754.1 | Ig-like domain-containing protein | - |
| LP473_RS10875 (LP473_10880) | - | 2171291..2172208 (-) | 918 | WP_252174755.1 | phage capsid protein | - |
| LP473_RS10880 (LP473_10885) | - | 2172223..2173275 (-) | 1053 | WP_137016559.1 | XkdF-like putative serine protease domain-containing protein | - |
| LP473_RS10885 (LP473_10890) | - | 2173291..2174121 (-) | 831 | WP_014570553.1 | phage minor head protein | - |
| LP473_RS10890 (LP473_10895) | - | 2174114..2175643 (-) | 1530 | WP_252174756.1 | phage portal protein | - |
| LP473_RS10895 (LP473_10900) | - | 2175709..2176746 (-) | 1038 | WP_252174757.1 | DUF4062 domain-containing protein | - |
| LP473_RS10900 (LP473_10905) | - | 2176811..2178109 (-) | 1299 | WP_252174758.1 | PBSX family phage terminase large subunit | - |
| LP473_RS10905 (LP473_10910) | - | 2178069..2178569 (-) | 501 | WP_240834890.1 | terminase small subunit | - |
| LP473_RS10910 (LP473_10915) | - | 2178743..2179132 (-) | 390 | WP_031561062.1 | DUF722 domain-containing protein | - |
| LP473_RS10915 (LP473_10920) | - | 2179210..2179371 (-) | 162 | WP_003131301.1 | hypothetical protein | - |
| LP473_RS10920 (LP473_10925) | - | 2179816..2180016 (-) | 201 | WP_252174759.1 | DUF1660 domain-containing protein | - |
| LP473_RS10925 (LP473_10930) | - | 2180013..2180252 (-) | 240 | WP_095346056.1 | hypothetical protein | - |
| LP473_RS10930 (LP473_10935) | - | 2180271..2180606 (-) | 336 | WP_252174760.1 | DUF1140 family protein | - |
| LP473_RS10935 (LP473_10940) | - | 2180603..2181004 (-) | 402 | WP_252174761.1 | hypothetical protein | - |
| LP473_RS10940 (LP473_10945) | - | 2181001..2181426 (-) | 426 | WP_252174762.1 | hypothetical protein | - |
| LP473_RS10945 (LP473_10950) | dut | 2181429..2181848 (-) | 420 | WP_252174763.1 | dUTP diphosphatase | - |
| LP473_RS10950 (LP473_10955) | - | 2181845..2182447 (-) | 603 | WP_252174764.1 | DUF1642 domain-containing protein | - |
| LP473_RS10955 (LP473_10960) | - | 2182444..2182833 (-) | 390 | WP_252174765.1 | YopX family protein | - |
| LP473_RS10960 (LP473_10965) | - | 2182851..2183039 (-) | 189 | WP_063282975.1 | hypothetical protein | - |
| LP473_RS10965 (LP473_10970) | - | 2183234..2183509 (-) | 276 | WP_014570536.1 | hypothetical protein | - |
| LP473_RS10970 (LP473_10975) | - | 2183518..2183724 (-) | 207 | WP_014570535.1 | hypothetical protein | - |
| LP473_RS10975 (LP473_10980) | - | 2183835..2184074 (-) | 240 | WP_058225578.1 | DUF1031 family protein | - |
| LP473_RS10980 (LP473_10985) | - | 2184071..2184376 (-) | 306 | WP_242166684.1 | hypothetical protein | - |
| LP473_RS10985 (LP473_10990) | - | 2184381..2184764 (-) | 384 | WP_252174766.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LP473_RS10990 (LP473_10995) | - | 2184777..2185019 (-) | 243 | WP_252174767.1 | L-rhamnose isomerase | - |
| LP473_RS10995 (LP473_11000) | - | 2185012..2185938 (-) | 927 | WP_252174768.1 | phage replisome organizer N-terminal domain-containing protein | - |
| LP473_RS11000 (LP473_11005) | - | 2186202..2187128 (-) | 927 | WP_252174769.1 | RecT family recombinase | - |
| LP473_RS11005 (LP473_11010) | - | 2187125..2187958 (-) | 834 | WP_252174770.1 | hypothetical protein | - |
| LP473_RS11010 (LP473_11015) | - | 2188061..2188309 (-) | 249 | WP_014570815.1 | hypothetical protein | - |
| LP473_RS12750 | - | 2188323..2188445 (-) | 123 | WP_023164646.1 | hypothetical protein | - |
| LP473_RS11015 (LP473_11020) | - | 2188442..2188624 (-) | 183 | WP_003130605.1 | hypothetical protein | - |
| LP473_RS11020 (LP473_11025) | - | 2188688..2188897 (-) | 210 | WP_023349177.1 | helix-turn-helix transcriptional regulator | - |
| LP473_RS11025 (LP473_11030) | - | 2189089..2189511 (+) | 423 | WP_023349178.1 | helix-turn-helix transcriptional regulator | - |
| LP473_RS11030 (LP473_11035) | - | 2189522..2190106 (+) | 585 | WP_014570821.1 | hypothetical protein | - |
| LP473_RS11035 (LP473_11040) | - | 2190162..2190701 (+) | 540 | WP_023189015.1 | PH domain-containing protein | - |
| LP473_RS11040 (LP473_11045) | - | 2190827..2192284 (+) | 1458 | WP_031561103.1 | recombinase family protein | - |
| LP473_RS11045 (LP473_11050) | - | 2192281..2192421 (-) | 141 | WP_228777719.1 | hypothetical protein | - |
| LP473_RS11050 (LP473_11055) | comGB | 2192435..2193454 (-) | 1020 | WP_043991179.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| LP473_RS11055 (LP473_11060) | comGA | 2193402..2194341 (-) | 940 | Protein_2157 | competence type IV pilus ATPase ComGA | - |
| LP473_RS11060 (LP473_11065) | - | 2194461..2199377 (-) | 4917 | WP_194942667.1 | PolC-type DNA polymerase III | - |
| LP473_RS11065 (LP473_11070) | - | 2199550..2200086 (-) | 537 | WP_003130594.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 89 a.a. Molecular weight: 10123.56 Da Isoelectric Point: 4.2950
>NTDB_id=631069 LP473_RS10775 WP_003129998.1 2155913..2156182(-) (comGC) [Lactococcus lactis subsp. lactis strain IBB417]
MLIVLAIISILILLFVPNLIKEKSQVQKTGEAAVVKVVESQAQLYELDHDDEKPSLPELLSAGMITQKQISAYDNYYDQN
KNEERNFND
MLIVLAIISILILLFVPNLIKEKSQVQKTGEAAVVKVVESQAQLYELDHDDEKPSLPELLSAGMITQKQISAYDNYYDQN
KNEERNFND
Nucleotide
Download Length: 270 bp
>NTDB_id=631069 LP473_RS10775 WP_003129998.1 2155913..2156182(-) (comGC) [Lactococcus lactis subsp. lactis strain IBB417]
ATGTTAATTGTACTAGCTATTATTAGTATTTTAATATTACTATTTGTTCCAAATTTAATTAAAGAAAAATCACAAGTTCA
AAAAACTGGAGAAGCGGCAGTTGTAAAAGTAGTAGAAAGTCAAGCTCAACTTTATGAATTAGATCATGATGATGAGAAGC
CGAGTCTGCCAGAATTGCTCAGCGCTGGGATGATTACTCAAAAACAAATTTCTGCTTACGATAATTACTATGATCAGAAC
AAAAATGAAGAACGAAATTTTAATGACTAG
ATGTTAATTGTACTAGCTATTATTAGTATTTTAATATTACTATTTGTTCCAAATTTAATTAAAGAAAAATCACAAGTTCA
AAAAACTGGAGAAGCGGCAGTTGTAAAAGTAGTAGAAAGTCAAGCTCAACTTTATGAATTAGATCATGATGATGAGAAGC
CGAGTCTGCCAGAATTGCTCAGCGCTGGGATGATTACTCAAAAACAAATTTCTGCTTACGATAATTACTATGATCAGAAC
AAAAATGAAGAACGAAATTTTAATGACTAG
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Lactococcus lactis subsp. cremoris KW2 |
86.667 |
84.27 |
0.73 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
55.056 |
100 |
0.551 |
| comGC/cglC | Streptococcus pneumoniae D39 |
55.056 |
100 |
0.551 |
| comGC/cglC | Streptococcus pneumoniae R6 |
55.056 |
100 |
0.551 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
55.056 |
100 |
0.551 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.471 |
95.506 |
0.539 |
| comYC | Streptococcus suis isolate S10 |
58.904 |
82.022 |
0.483 |
| comGC/cglC | Streptococcus mitis SK321 |
53.947 |
85.393 |
0.461 |
| comYC | Streptococcus mutans UA140 |
50.685 |
82.022 |
0.416 |
| comYC | Streptococcus mutans UA159 |
50.685 |
82.022 |
0.416 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
56.25 |
71.91 |
0.404 |